DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdh22 and CadN2

DIOPT Version :9

Sequence 1:NP_062034.2 Gene:Cdh22 / 29182 RGDID:2321 Length:813 Species:Rattus norvegicus
Sequence 2:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster


Alignment Length:583 Identity:167/583 - (28%)
Similarity:274/583 - (46%) Gaps:84/583 - (14%)


- Green bases have known domain annotations that are detailed below.


  Rat    68 VVEEYTGTEPLYVGKIHSDSDEGDGTIK--YTISGEG------AGTIFLIDELTGDIHATERLDR 124
            :.||.....|..:.::.:...:.|..|.  |.::|:|      |.:.|.|:..||||...:.|||
  Fly   145 ITEEDDRNLPKRILQVTATDGDVDRPINIVYFLTGQGIDPDNPANSKFDINRTTGDIFVLKPLDR 209

  Rat   125 EQ---KTFYTLRAQARDRATNRLLEPESEFIIKVQDINDSEPRFLHGPYIGSVAELSPTGTSVMQ 186
            :|   :..:.....|:|.....|: ..::..:.::||||:.|:|..|.|.|:|.|....|:|||.
  Fly   210 DQPNGRPQWRFTVFAQDEGGEGLV-GYADIQVNLKDINDNAPQFPQGIYFGNVTENGTAGSSVMT 273

  Rat   187 VMASDADDPTYGSSARLVYSV-------LDGEHHFTVDPKTGVIRTAVPDLDRESQERYEVVIQA 244
            :.|.|.|||...::|:|:||:       ..|...|.::|:||:|:|||..||||....|.:.:.|
  Fly   274 MSAVDYDDPNESTNAKLIYSIEKNVIEEETGAPIFEIEPETGLIKTAVCCLDRERTPDYSIQVVA 338

  Rat   245 TDMAGQLGGLSGSTTVTIVVTDVNDNPPRFPQKMYQFSIQES-------APIGTAVGRVKAEDSD 302
            .|.    |||.|:.|.:|.|.|:||.||:|.:..:...:.|:       .||.|    |..:|.|
  Fly   339 MDG----GGLKGTGTASIRVKDLNDMPPQFTKDEWVTEVDETNGTYIPETPILT----VTVQDED 395

  Rat   303 VGENTDMTYHLREESGSGGDAFKVTTDSDTQEAIIVVQKHLDFESQQVHTVVLEALNKFVDPRFA 367
              |.....|.:...||.|.|.|.:..:.|...::.::|. ||:|                ||..:
  Fly   396 --ETNTFQYKVVPNSGFGADKFAMVRNGDGTGSLKIIQP-LDYE----------------DPLQS 441

  Rat   368 DLGTFRDQ-------------------AIVRVAVTDV-DEPPEFRPPSGLLEVQEDAQVGSLVGV 412
            ....||.|                   :.|.|.:.|: |..|:|......:.:.||.:||:::..
  Fly   442 SGFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRDINDNVPKFDREHIEVSIYEDTKVGTILEQ 506

  Rat   413 VTARDPD-AANRPVRYAIDRDSDLEQIFDIDADTGAIVTGKGLDRETAGWHNITVLAMEADNHAQ 476
            ..|.|.| ..:..|.|.|.|.::.::.|.| :|.||:...:.|||||...|:|.:||::..:.|:
  Fly   507 FKATDADQGGHSKVAYKIVRSTNRKRQFAI-SDRGAVSIQRPLDRETQDRHHIQILAIDDGSPAR 570

  Rat   477 LSRASLRIRILDVNDNPPELATPYEAAVCEDAKPGQLIQTISVVDRDEPQGGH--RFYFRLVP-- 537
            .:.|:|.:.:.|||||.|..|..|:..:.|:.. |:.|..::..|.|:...|:  .|.|||.|  
  Fly   571 TATATLTVIVKDVNDNAPTFAQDYKPTLPENVS-GKKILEVAAKDPDDRLRGNGGPFTFRLDPLA 634

  Rat   538 ----EEPSNPHFSLLDIEDNTAAVHTQHVGFNRQEQDVFLLPILVVDSGPPTLSSTGTLTIRI 596
                :......:......:|..|:.:....|:|:.|..:.:||.:.|:|.|.::.|.|||:.|
  Fly   635 SDEIKAGFKVEYDRRGDNENGVAIISSLRPFDREAQKSYAIPIEIKDNGAPAMTGTSTLTVTI 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdh22NP_062034.2 Cadherin_repeat 80..160 CDD:206637 21/90 (23%)
Cadherin_repeat 169..270 CDD:206637 42/107 (39%)
Cadherin_repeat 279..387 CDD:206637 27/134 (20%)
Cadherin_repeat 398..492 CDD:206637 31/94 (33%)
Cadherin_repeat 499..597 CDD:206637 27/106 (25%)
Cadherin_C 645..804 CDD:395833
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 696..726
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 25/103 (24%)
Cadherin_repeat 256..359 CDD:206637 41/106 (39%)
Cadherin_repeat 379..481 CDD:206637 26/124 (21%)
Cadherin_repeat 489..586 CDD:206637 31/97 (32%)
Cadherin_repeat 594..703 CDD:206637 27/105 (26%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9369
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24027
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.