DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctsk and CG5367

DIOPT Version :9

Sequence 1:NP_113748.1 Gene:Ctsk / 29175 RGDID:61810 Length:329 Species:Rattus norvegicus
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:308 Identity:113/308 - (36%)
Similarity:178/308 - (57%) Gaps:11/308 - (3%)


- Green bases have known domain annotations that are detailed below.


  Rat    24 TQWELWKKTHGKQYNSKVDEISRRLIWEKNLKKISVHNLEASLGAHTYELAMNHLGDMTSEEVVQ 88
            :::|.:|..:.::|....||:.....:|:|.|.|..||.....|..::.|..|...||:::..::
  Fly    34 SEFEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTDGYLK 98

  Rat    89 ---KMTGLRVPPSRSFSNDTLYTPEWEGRVPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEG 150
               ::....:..|.....:.:.:| ....||:|:|:|.||::||..||..||||:|||.|.::.|
  Fly    99 GFLRLLKSNIEDSADNMAEIVGSP-LMANVPESLDWRSKGFITPPYNQLSCGSCYAFSIAESIMG 162

  Rat   151 QLKKKTGKLLALSPQNLVDC-VSE-NYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYN 213
            |:.|:|||:|:||.|.:||| ||. |.||.||.:.....|:|..|||..:..||||.:...|.:.
  Fly   163 QVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKGKCQFV 227

  Rat   214 ATAKAAKCRGYREIPVGNEKALKRAVARVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAV 278
            ..........:..:||.:|:|::.||..:|||::||:||..:||.||.|:|.|..|...:||||:
  Fly   228 PDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSASVNHAM 292

  Rat   279 LVVGYGTQKGNKYWIIKNSWGESWGNKGYVLLARNKNNACGITNLASF 326
            :|:|:    |..|||:||.||::||..||:.: |...|.|||.|.|::
  Fly   293 VVIGF----GKDYWILKNWWGQNWGENGYIRI-RKGVNMCGIANYAAY 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtskNP_113748.1 Inhibitor_I29 26..85 CDD:214853 16/58 (28%)
Peptidase_C1 115..327 CDD:278538 95/214 (44%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 16/59 (27%)
Peptidase_C1A 128..336 CDD:239068 94/213 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.