DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hpn and CG11836

DIOPT Version :9

Sequence 1:XP_038958880.1 Gene:Hpn / 29135 RGDID:61982 Length:559 Species:Rattus norvegicus
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:266 Identity:99/266 - (37%)
Similarity:142/266 - (53%) Gaps:30/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Rat   179 CDCPRGRFLTATCQDCGRRKLPVDRIVGGQDSSLGRWPWQVSLRYDGTHLCGGSLLSGDWVLTAA 243
            |||           |||.....: |||||:.:.:.::||...:.|||...||||||:.|:||:||
  Fly    84 CDC-----------DCGFSNEEI-RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAA 136

  Rat   244 HCFPERNRVLSRWRVFAG---AVARTSPHAVQLGVQAVIYHGGYLPFRDPTIDENSNDIALVHLS 305
            ||..:..:  |:.||..|   ....:...|:|..|.|||.|..:    ||  |..:|||||:.|.
  Fly   137 HCVKKLRK--SKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSF----DP--DTYNNDIALLRLR 193

  Rat   306 SSLPLTEYIQPVCLPAAGQALVDGKVCTVTGWGNTQFYGQQAVVLQEARVPIISNEVCNSPDFYG 370
            ..:..::.|:|:|||....... |::.||.|||.|...|:...::.:.:|||:|...|.:..:..
  Fly   194 KPISFSKIIKPICLPRYNYDPA-GRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKS 257

  Rat   371 NQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDRISGTSRWRLCGIVSWGTGCALARKPGVYTKVI 435
            .:|...|.|||.|  .:|:||||||||.:    :|...::.:.||||||.||.....||||::|.
  Fly   258 TRITSSMLCAGRP--SMDSCQGDSGGPLL----LSNGVKYFIVGIVSWGVGCGREGYPGVYSRVS 316

  Rat   436 DFREWI 441
            .|..||
  Fly   317 KFIPWI 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HpnXP_038958880.1 Hepsin-SRCR 92..200 CDD:401275 6/20 (30%)
Tryp_SPc 204..441 CDD:238113 90/239 (38%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 92/241 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12330
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.