DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD274 and dpr6

DIOPT Version :9

Sequence 1:NP_054862.1 Gene:CD274 / 29126 HGNCID:17635 Length:290 Species:Homo sapiens
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:150 Identity:37/150 - (24%)
Similarity:60/150 - (40%) Gaps:42/150 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    11 TYWHLLNAFTVTVP-------KDLYVVEYGSNMTIEC--KFPVEKQLDLAALIVYWEMEDKNIIQ 66
            :|:..||   |.||       .||: |:.||.:.:.|  ||..|     ....::|         
  Fly   166 SYFVRLN---VVVPTATILGGPDLH-VDKGSTINLTCTVKFSPE-----PPAYIFW--------- 212

Human    67 FVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVN 131
             .|.||  .:.:.|.|....::.::..:..:.|.|.:..|.|:|.|.|..|  .||...:.|.| 
  Fly   213 -YHHEE--VINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPS--NADVASVRVHV- 271

Human   132 APYNKINQRILVVDPVTSEH 151
                 :|.|.:    ::.||
  Fly   272 -----LNVRAI----ISGEH 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD274NP_054862.1 Ig 54..117 CDD:325142 13/62 (21%)
Ig 135..220 CDD:325142 3/16 (19%)
dpr6NP_001287018.1 V-set 79..174 CDD:284989 3/10 (30%)
IG_like 80..175 CDD:214653 4/11 (36%)
IG_like 184..271 CDD:214653 26/106 (25%)
IGc2 191..262 CDD:197706 20/89 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.