DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD274 and side-III

DIOPT Version :9

Sequence 1:NP_054862.1 Gene:CD274 / 29126 HGNCID:17635 Length:290 Species:Homo sapiens
Sequence 2:NP_001036681.1 Gene:side-III / 4379844 FlyBaseID:FBgn0083949 Length:1689 Species:Drosophila melanogaster


Alignment Length:222 Identity:52/222 - (23%)
Similarity:86/222 - (38%) Gaps:51/222 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     1 MRIFAVFIFMTYWHLLN-----------AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALI 54
            :.:||:|:|..:..|.:           ..||.|...|     |...::.|....|.:.|...::
  Fly    26 LALFALFLFAAHISLTSGQIDWDDDDDPVSTVAVEAVL-----GRTASLPCDIEPEAKDDRVYMV 85

Human    55 VYW-EMEDKNIIQF-VHGEEDLKVQH----SSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYR 113
            ::: |...|.:..| |.|....|..:    :|:..||..:..|..   |.|.:.:::|.|.||||
  Fly    86 LWFRESAGKPLYSFDVRGRPFEKALYWSDTNSFGPRAYFVTGQQP---AKLSVDNIQLDDEGVYR 147

Human   114 CMISYGGADYK--RITVKVNAPYNKINQRILVVD-----------PVTSEHE--LTCQAE-GYPK 162
            |.:.:..:..:  ||.:.|..|    ..:|||.|           |:.....  |||:.. |.|:
  Fly   148 CRVDFQNSPTRNHRINLTVIVP----PHQILVYDASGRDVAGAVGPLLEGDNIVLTCEVRGGRPE 208

Human   163 AEVIWTSSDHQ------VLSGKTTTTN 183
            ..|.|.:....      |..|:..|.|
  Fly   209 PTVTWMNGTRTLEAGSGVSMGRHVTVN 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD274NP_054862.1 Ig 54..117 CDD:325142 19/68 (28%)
Ig 135..220 CDD:325142 16/69 (23%)
side-IIINP_001036681.1 IG_like 59..166 CDD:214653 27/114 (24%)
V-set 59..166 CDD:284989 27/114 (24%)
ig 190..268 CDD:278476 11/46 (24%)
IG_like 192..259 CDD:214653 11/44 (25%)
Ig 296..361 CDD:299845
IG_like 391..468 CDD:214653
IGc2 392..454 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.