DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD274 and CG5597

DIOPT Version :9

Sequence 1:NP_054862.1 Gene:CD274 / 29126 HGNCID:17635 Length:290 Species:Homo sapiens
Sequence 2:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster


Alignment Length:172 Identity:34/172 - (19%)
Similarity:64/172 - (37%) Gaps:46/172 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    38 IECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQH------SSYRQRARLLKDQLSLGN 96
            ::|.:.||:....  :.|.|..:||:|.|::.|.....:..      |:|.......|...||. 
  Fly    44 LDCDYEVEESPKF--ITVKWYRDDKSIYQWIFGTPPYAIPEFRNEIDSTYESSTEPSKQYSSLA- 105

Human    97 AALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVD-----------PVTSE 150
                :.:..:...|.|:|:            |:.:......:||:.|:|           .:.:|
  Fly   106 ----LINPTIATTGDYKCV------------VQTSLNTFSSHQRVQVIDLRNYTLELSHKTIHNE 154

Human   151 HELTCQAEG-YPKAEVIWTSSDHQVLSGKTTTTNSKREEKLF 191
            .:|.|.... ||:..:...|:|..|:         |||..::
  Fly   155 TQLNCTVTNVYPRPTITIISNDMDVV---------KREPMVY 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD274NP_054862.1 Ig 54..117 CDD:325142 15/68 (22%)
Ig 135..220 CDD:325142 15/69 (22%)
CG5597NP_611841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.