| Sequence 1: | NP_054862.1 | Gene: | CD274 / 29126 | HGNCID: | 17635 | Length: | 290 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001246162.1 | Gene: | Dscam1 / 35652 | FlyBaseID: | FBgn0033159 | Length: | 2038 | Species: | Drosophila melanogaster |
| Alignment Length: | 237 | Identity: | 57/237 - (24%) |
|---|---|---|---|
| Similarity: | 94/237 - (39%) | Gaps: | 54/237 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Human 20 TVTVPKDLYVVE-------YGSNMTIECK---FPVEKQLDLAALIVYWEMEDKNIIQFVHGE-ED 73
Human 74 LKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYG-GADYKR-ITVKVNAP--- 133
Human 134 YNKI-NQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKL-FNVTST 196
Human 197 LRINTT---TNEIFYCTFRRLDPEENHTAELV---IPELPLA 232 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CD274 | NP_054862.1 | Ig | 54..117 | CDD:325142 | 13/63 (21%) |
| Ig | 135..220 | CDD:325142 | 22/89 (25%) | ||
| Dscam1 | NP_001246162.1 | Ig | 38..130 | CDD:299845 | |
| IG | 57..133 | CDD:214652 | |||
| IG_like | 267..343 | CDD:214653 | |||
| Ig | 269..340 | CDD:143165 | |||
| IG_like | 353..425 | CDD:214653 | |||
| IGc2 | 361..413 | CDD:197706 | |||
| I-set | 433..527 | CDD:254352 | |||
| IGc2 | 446..517 | CDD:197706 | |||
| I-set | 533..618 | CDD:254352 | |||
| IGc2 | 544..607 | CDD:197706 | |||
| Ig | 641..714 | CDD:143165 | |||
| IGc2 | 735..804 | CDD:197706 | 21/92 (23%) | ||
| I-set | 819..914 | CDD:254352 | 22/99 (22%) | ||
| Ig | 833..921 | CDD:299845 | 21/92 (23%) | ||
| FN3 | 918..1011 | CDD:238020 | 4/6 (67%) | ||
| FN3 | 1018..1116 | CDD:238020 | |||
| FN3 | 1124..1217 | CDD:238020 | |||
| FN3 | 1222..1312 | CDD:238020 | |||
| Ig | 1339..1406 | CDD:299845 | |||
| FN3 | 1409..1499 | CDD:238020 | |||
| FN3 | 1504..1584 | CDD:238020 | |||
| Dscam_C | 1890..2008 | CDD:289151 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||