DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYLIP and Diap2

DIOPT Version :9

Sequence 1:NP_037394.2 Gene:MYLIP / 29116 HGNCID:21155 Length:445 Species:Homo sapiens
Sequence 2:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster


Alignment Length:60 Identity:25/60 - (41%)
Similarity:38/60 - (63%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   374 LQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVEHVQHVYL 433
            |:|:.|:||:|.||.||.:||:...|.||||...|..||..:.:||:||:.::.....:|
  Fly   438 LEEENRQLKDARLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFL 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYLIPNP_037394.2 B41 5..190 CDD:214604
FERM_C_MYLIP_IDOL 185..295 CDD:270016
RING-HC_MYLIP 386..423 CDD:319437 17/36 (47%)
RING-HC finger (C3HC4-type) 387..421 CDD:319437 15/33 (45%)
Critical for homodimerization 431..433 0/1 (0%)
Diap2NP_477127.1 BIR 12..78 CDD:237989
BIR 112..181 CDD:197595
BIR 213..281 CDD:237989
UBA_IAPs 320..363 CDD:270506
zf-C3HC4_3 447..492 CDD:290631 19/44 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340284at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.