DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBK1 and SSK22

DIOPT Version :9

Sequence 1:NP_037386.1 Gene:TBK1 / 29110 HGNCID:11584 Length:729 Species:Homo sapiens
Sequence 2:NP_009998.2 Gene:SSK22 / 850436 SGDID:S000000669 Length:1331 Species:Saccharomyces cerevisiae


Alignment Length:256 Identity:68/256 - (26%)
Similarity:117/256 - (45%) Gaps:43/256 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     9 WLLSDILGQGATANVFRGRHKKTGDLFA---IKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKL 70
            |.....:|.|....|:...:.:.|::.|   ||:.:..:..:...:...|..||:.|||.|||:.
Yeast  1034 WQKRSFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQY 1098

Human    71 FAIEEETTTRHKV-LIMEFCPCGSLYTVLEEPSNAYGLPESEFL--IVLRDVVGGMNHLRENGIV 132
            :.:|   ..|.|| :.||:|..|||.::|:     :|..|.|.:  :...:::.|:.:|.::|:|
Yeast  1099 YGVE---VHRDKVNIFMEYCEGGSLASLLD-----HGRIEDEMVTQVYTFELLEGLAYLHQSGVV 1155

Human   133 HRDIKPGNIMRVIGEDGQSVYKLTDFGAAREL-----------------EDDEQFVSLYGTEEYL 180
            ||||||.||:.    |...:.|..|||.||.:                 .:.:....:.||..|:
Yeast  1156 HRDIKPENILL----DFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYM 1216

Human   181 HPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGK 241
            .|:....:.::    .|.||. |:|::|......|||.   ||:........:||.:..|:
Yeast  1217 APETISGSAVK----GKLGAD-DVWALGCVVLEMATGR---RPWSNLDNEWAIMYHVAAGR 1269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBK1NP_037386.1 S_TKc 9..242 CDD:214567 68/256 (27%)
STKc_TBK1 15..330 CDD:270890 67/250 (27%)
UBL_TBK1_like 297..385 CDD:240618
Interaction with AZI2, TANK and TBKBP1. /evidence=ECO:0000269|PubMed:21931631 621..729
SSK22NP_009998.2 STKc_MEKK4 1033..1309 CDD:270796 68/256 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.