DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBK1 and mek1

DIOPT Version :9

Sequence 1:NP_037386.1 Gene:TBK1 / 29110 HGNCID:11584 Length:729 Species:Homo sapiens
Sequence 2:NP_594908.1 Gene:mek1 / 2541604 PomBaseID:SPAC14C4.03 Length:445 Species:Schizosaccharomyces pombe


Alignment Length:346 Identity:81/346 - (23%)
Similarity:149/346 - (43%) Gaps:84/346 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    14 ILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKL-------- 70
            :||.|..:.::......||..:|.|:.:..........:..|..:|:||:|.||:|:        
pombe   165 LLGIGGFSRIYMAMDNNTGGQYACKIIDKKKISTKRFFEDHEMTILRKLDHPNIIKVNMEYNSET 229

Human    71 -FAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHR 134
             |.|.||..|.           |.|::.|.:...   :||...|.::..::.|:.:|.|..|:||
pombe   230 QFFIFEEMVTG-----------GDLFSYLTKLGT---VPEVTTLFIMFQILQGLKYLHEQNIIHR 280

Human   135 DIKPGNIMRVIGEDGQSVYK--LTDFGAARELEDDEQFVSLYGTEEYLHPDMYE---RAVLRKDH 194
            |:|..||:  |.....::::  |||||.||.::..::..:..||.||..|::..   |:.:.|::
pombe   281 DLKLENIL--IASSSDTIFRIILTDFGVARCMQKGKRLSTFVGTPEYTAPEIQRLKGRSQVEKEN 343

Human   195 QKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDW 259
            ...||..|||||:||                       :|:.:::|.......||::.:   :|:
pombe   344 SSGYGKEVDLWSLGV-----------------------IMFLLLSGNSPSFADGVKEKQ---VDF 382

Human   260 SGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKI 324
            ..  ||..|:||..:.|    ::|:|:.:..     |:                |:::|..:|..
pombe   383 RD--PVWKSVSRQAKDL----ISNLLKTNPP-----DR----------------FTVKQCLSHPW 420

Human   325 YI-HSYNTATIFHELVYKQTK 344
            :. ||.....::...:.|..|
pombe   421 FARHSSRLTKLYETRILKPLK 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBK1NP_037386.1 S_TKc 9..242 CDD:214567 62/241 (26%)
STKc_TBK1 15..330 CDD:270890 79/329 (24%)
UBL_TBK1_like 297..385 CDD:240618 7/49 (14%)
Interaction with AZI2, TANK and TBKBP1. /evidence=ECO:0000269|PubMed:21931631 621..729
mek1NP_594908.1 FHA 39..141 CDD:238017
STKc_CAMK 163..420 CDD:270687 77/323 (24%)
S_TKc 164..421 CDD:214567 77/324 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.