DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PYCARD and Pycard

DIOPT Version :9

Sequence 1:NP_037390.2 Gene:PYCARD / 29108 HGNCID:16608 Length:195 Species:Homo sapiens
Sequence 2:NP_075747.3 Gene:Pycard / 66824 MGIID:1931465 Length:193 Species:Mus musculus


Alignment Length:195 Identity:140/195 - (71%)
Similarity:159/195 - (81%) Gaps:2/195 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYG 65
            |||||||||||||||:.:||||||:|||:|.||||||||||||||.|||:||||||||:|||:||
Mouse     1 MGRARDAILDALENLSGDELKKFKMKLLTVQLREGYGRIPRGALLQMDAIDLTDKLVSYYLESYG 65

Human    66 AELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVE 130
            .|||..|||||||||:|.||| .|.:.|||..|....|.||.|:.| ||:||||.|||||||.|:
Mouse    66 LELTMTVLRDMGLQELAEQLQ-TTKEESGAVAAAASVPAQSTARTG-HFVDQHRQALIARVTEVD 128

Human   131 WLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS 195
            .:||||:|.|||:.||||||||.|:..||||||||.|:||.||||.|||||:|...|||.|||:|
Mouse   129 GVLDALHGSVLTEGQYQAVRAETTSQDKMRKLFSFVPSWNLTCKDSLLQALKEIHPYLVMDLEQS 193

Human   196  195
            Mouse   194  193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PYCARDNP_037390.2 Pyrin_ASC-like 5..86 CDD:260033 65/80 (81%)
CARD_ASC_NALP1 113..193 CDD:260039 56/79 (71%)
PycardNP_075747.3 Pyrin_ASC-like 5..86 CDD:260033 65/80 (81%)
CARD_ASC_NALP1 111..191 CDD:260039 56/79 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83953022
Domainoid 1 1.000 124 1.000 Domainoid score I39479
eggNOG 1 0.900 - - E1_2CYBZ
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8307
Inparanoid 1 1.050 267 1.000 Inparanoid score I15507
Isobase 1 0.950 - 0 Normalized mean entropy S9765
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG41811
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002022
OrthoInspector 1 1.000 - - oto113997
orthoMCL 1 0.900 - - OOG6_114527
Panther 1 1.100 - - LDO PTHR10454
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7505
SonicParanoid 1 1.000 - - X3863
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1717.240

Return to query results.
Submit another query.