DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PYCARD and pycard

DIOPT Version :9

Sequence 1:NP_037390.2 Gene:PYCARD / 29108 HGNCID:16608 Length:195 Species:Homo sapiens
Sequence 2:NP_571570.2 Gene:pycard / 57923 ZFINID:ZDB-GENE-000511-2 Length:203 Species:Danio rerio


Alignment Length:199 Identity:68/199 - (34%)
Similarity:106/199 - (53%) Gaps:14/199 - (7%)


- Green bases have known domain annotations that are detailed below.


Human     5 RDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSM-DALDLTDKLVSFYLETYGAEL 68
            ::.:.:|.|:|.|:.|:|||.||..   |....|:.:.|:..: |.:||.|.:|..:.......:
Zfish     6 KEHLQEAFEDLGADNLRKFKSKLGD---RRQEPRVTKSAIEKLKDEIDLADLMVGVFTSKDAVSV 67

Human    69 TANVLRDMGLQEMAGQLQAATHQG-SGAAPAGIQ--APPQSAAKPG---LHFIDQHRAALIARVT 127
            |..:||.:....:|..|...|.|. |..||:...  |..::.:|..   ::|||:|...||.||.
Zfish    68 TVEILRAIKCIAVADDLLRNTGQSESKGAPSDESKCASSKAVSKVAFSKVNFIDEHWKELIDRVN 132

Human   128 NVEWLLDAL-YGKVLTDEQYQAVRAEPTNPSKMRKLFS--FTPAWNWTCKDLLLQALRESQSYLV 189
            ||:.:||.| ..||:|:|.|..:|.:.|...|||:|.:  .|.|.| ..|::|..|||||..:|:
Zfish   133 NVDPILDILRQKKVITNEDYCTIRNKETPQKKMRELLTGPITCAGN-KGKEVLYDALRESNKFLM 196

Human   190 EDLE 193
            :|||
Zfish   197 DDLE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PYCARDNP_037390.2 Pyrin_ASC-like 5..86 CDD:260033 22/81 (27%)
CARD_ASC_NALP1 113..193 CDD:260039 36/82 (44%)
pycardNP_571570.2 Pyrin_ASC-like 6..86 CDD:260033 23/82 (28%)
CARD_ASC_NALP1 118..200 CDD:260039 36/82 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I34402
eggNOG 1 0.900 - - E1_2CYBZ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I12360
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG41811
OrthoDB 1 1.010 - - D1494108at2759
OrthoFinder 1 1.000 - - FOG0002022
OrthoInspector 1 1.000 - - oto43000
orthoMCL 1 0.900 - - OOG6_114527
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3863
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 1 1.500 - -
1414.240

Return to query results.
Submit another query.