DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PYCARD and Decay

DIOPT Version :9

Sequence 1:NP_037390.2 Gene:PYCARD / 29108 HGNCID:16608 Length:195 Species:Homo sapiens
Sequence 2:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster


Alignment Length:151 Identity:36/151 - (23%)
Similarity:56/151 - (37%) Gaps:37/151 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    48 DALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQ---------LQAATHQGSGAAPAGIQAP 103
            |.::.|.:...|.:.|:. :||.:.:.|. |:|:|.:         |...:|...|...|...:.
  Fly    80 DDMEATLQGFGFDVRTFD-DLTFSEINDT-LKEVAREDHSQNDCFVLAVMSHGTEGKVYAKDMSY 142

Human   104 PQSAA--------------KPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVR---- 150
            |....              ||.|.||...|.|.:.:.  ||:...|:..:.|..|...||:    
  Fly   143 PVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKA--VEFSSFAVMTRELVPEPAAAVQPITY 205

Human   151 AEPTNP------SKMRKLFSF 165
            |.|:..      |...|.|||
  Fly   206 AIPSTADILVFYSTFDKFFSF 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PYCARDNP_037390.2 Pyrin_ASC-like 5..86 CDD:260033 10/46 (22%)
CARD_ASC_NALP1 113..193 CDD:260039 18/63 (29%)
DecayNP_477462.1 CASc 54..302 CDD:237997 36/151 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.