DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PYCARD and csp-3

DIOPT Version :10

Sequence 1:NP_037390.2 Gene:PYCARD / 29108 HGNCID:16608 Length:195 Species:Homo sapiens
Sequence 2:NP_493011.2 Gene:csp-3 / 190006 WormBaseID:WBGene00000821 Length:139 Species:Caenorhabditis elegans


Alignment Length:99 Identity:18/99 - (18%)
Similarity:35/99 - (35%) Gaps:25/99 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   120 AALIARVTNVEWLLDALYGKVLTDEQYQAVR--AEPTNPSKMRKLFSF--TPAW---------NW 171
            |..:.|....:..:|..:.::....|:...:  :..|:.|:...|.||  :|.:         .|
 Worm    10 AFFLQRAVRCDGFIDNFFDRIPKFFQFMKSKFPSHQTSSSQADLLVSFSTSPGFLSFKDETKDTW 74

Human   172 TCKDL------------LLQALRESQSYLVEDLE 193
            ..::|            |...|.|:...:||..|
 Worm    75 YIQELYRVIIENAKDTHLADLLTETNRRVVEKYE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PYCARDNP_037390.2 Pyrin_ASC-like 5..86 CDD:260033
CARD_ASC_NALP1 113..193 CDD:260039 17/97 (18%)
csp-3NP_493011.2 CASc <11..132 CDD:444667 17/98 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.