DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PYCARD and csp-2

DIOPT Version :9

Sequence 1:NP_037390.2 Gene:PYCARD / 29108 HGNCID:16608 Length:195 Species:Homo sapiens
Sequence 2:NP_001370851.1 Gene:csp-2 / 177391 WormBaseID:WBGene00000820 Length:826 Species:Caenorhabditis elegans


Alignment Length:99 Identity:25/99 - (25%)
Similarity:36/99 - (36%) Gaps:26/99 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    52 LTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFID 116
            :|| |..|..|.:...||.|                :..:...||...:|...||        :|
 Worm   101 MTD-LTRFRQEIFTKHLTFN----------------SNPESIDAATKNVQNVKQS--------LD 140

Human   117 QHRAALIARVTNVEWLLDALYGKVLTDEQYQAVR 150
            ..|..:..|:..::.|... .|..||.|||.|:|
 Worm   141 TWRDRIKERLDEIDRLCTE-EGDSLTPEQYSALR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PYCARDNP_037390.2 Pyrin_ASC-like 5..86 CDD:260033 8/33 (24%)
CARD_ASC_NALP1 113..193 CDD:260039 12/38 (32%)
csp-2NP_001370851.1 pneumo_PspA 239..>533 CDD:411490
PHA03418 <475..>563 CDD:177646
CASc 581..824 CDD:237997
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161461439
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.