powered by:
Protein Alignment PYCARD and csp-1
DIOPT Version :9
Sequence 1: | NP_037390.2 |
Gene: | PYCARD / 29108 |
HGNCID: | 16608 |
Length: | 195 |
Species: | Homo sapiens |
Sequence 2: | NP_001022452.1 |
Gene: | csp-1 / 175007 |
WormBaseID: | WBGene00000819 |
Length: | 536 |
Species: | Caenorhabditis elegans |
Alignment Length: | 51 |
Identity: | 16/51 - (31%) |
Similarity: | 24/51 - (47%) |
Gaps: | 13/51 - (25%) |
- Green bases have known domain annotations that are detailed below.
Human 9 LDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSF 59
|.|||:..| .:.||...::| ||..|...|::| |.::||
Worm 420 LPALEDKCA-PISKFWNLMMS--------RIMPGTFTSLNA----DVIISF 457
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C161461437 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.