DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eci2 and anox

DIOPT Version :10

Sequence 1:NP_001006967.1 Gene:Eci2 / 291075 RGDID:1359427 Length:391 Species:Rattus norvegicus
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:76 Identity:29/76 - (38%)
Similarity:36/76 - (47%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat    41 FENAMNQVKLLKKDPGNEVKLRLYALYKQATEGPCTMPKPGVFDFVNKAKWDAWNALGSLPKETA 105
            |..|...|.......|:...|..|..|||||.|||....||:.....|:||.||..||::.:..|
  Fly    13 FHLATEHVAKQSNSIGSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMSQSAA 77

  Rat   106 RQNYVDLVSSL 116
            ||.||..:..|
  Fly    78 RQAYVQKLQEL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eci2NP_001006967.1 ACBP 38..113 CDD:459982 28/71 (39%)
crotonase-like 134..389 CDD:474030
ECH-like 149..319
Microbody targeting signal. /evidence=ECO:0000255 389..391
anoxNP_001027085.1 ACBP 10..85 CDD:459982 28/71 (39%)
ANKYR <121..>231 CDD:440430
ANK repeat 148..179 CDD:293786
ANK repeat 181..212 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.