DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TMEM208 and CG8320

DIOPT Version :10

Sequence 1:NP_054906.2 Gene:TMEM208 / 29100 HGNCID:25015 Length:173 Species:Homo sapiens
Sequence 2:NP_611072.2 Gene:CG8320 / 36759 FlyBaseID:FBgn0034059 Length:174 Species:Drosophila melanogaster


Alignment Length:67 Identity:18/67 - (26%)
Similarity:29/67 - (43%) Gaps:8/67 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   209 TPGTDTPSDQPCCRGLYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEVI 273
            |.|..|.|..  .|....::|.|:.:|      :|..:|:.||..||..:........:.|:.|:
  Fly    86 TVGRQTYSSD--SRYSLQYQPPNDWQL------LIQYSNERDEGHYECQISSYPPLVYLVYLLVV 142

Human   274 VP 275
            ||
  Fly   143 VP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TMEM208NP_054906.2 TMEM208_SND2 8..156 CDD:428546
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..173
CG8320NP_611072.2 TMEM208_SND2 9..166 CDD:428546 18/67 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.