DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A4 and sesB

DIOPT Version :9

Sequence 1:NP_001142.2 Gene:SLC25A4 / 291 HGNCID:10990 Length:298 Species:Homo sapiens
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:292 Identity:236/292 - (80%)
Similarity:260/292 - (89%) Gaps:1/292 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     5 AWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLS 69
            |..|:|||.|||::||||||||||||||||||||||.|||||.:|||||::||.:||||||||.|
  Fly    20 AVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSS 84

Human    70 FWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPL 134
            ||||||||||||||||||||||||||||:||||||::.|||||||||||||||||||||||||||
  Fly    85 FWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPL 149

Human   135 DFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAK 199
            ||||||||||.||| .||||.|||:|:.|||||||:.|||:||.|||||||||||||||.||||:
  Fly   150 DFARTRLAADTGKG-GQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTAR 213

Human   200 GMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKD 264
            ||||||||..|::||.|||.||.|||:|||||||||||||||||||..:::|..|:.||..|||.
  Fly   214 GMLPDPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQ 278

Human   265 EGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 296
            ||..||||||:||:|||.||||||||||||||
  Fly   279 EGTGAFFKGAFSNILRGTGGAFVLVLYDEIKK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A4NP_001142.2 Solcar 1 6..98 77/91 (85%)
PTZ00169 7..298 CDD:240302 235/290 (81%)
Solcar 2 111..201 76/89 (85%)
Solcar 3 212..297 63/85 (74%)
Important for transport activity. /evidence=ECO:0000269|PubMed:27693233 235..240 4/4 (100%)
Nucleotide carrier signature motif. /evidence=ECO:0000250|UniProtKB:P02722 235..240 4/4 (100%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 80/95 (84%)
PTZ00169 23..312 CDD:240302 235/289 (81%)
Mito_carr 124..220 CDD:278578 83/96 (86%)
Mito_carr 223..312 CDD:278578 64/88 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 169 1.000 Domainoid score I3802
eggNOG 1 0.900 - - E1_KOG0749
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36058
Inparanoid 1 1.050 488 1.000 Inparanoid score I1434
Isobase 1 0.950 - 0 Normalized mean entropy S337
OMA 1 1.010 - - QHG54049
OrthoDB 1 1.010 - - D440386at33208
OrthoFinder 1 1.000 - - FOG0000386
OrthoInspector 1 1.000 - - mtm8481
orthoMCL 1 0.900 - - OOG6_100505
Panther 1 1.100 - - O PTHR45635
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R28
SonicParanoid 1 1.000 - - X286
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.860

Return to query results.
Submit another query.