DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LGALSL and CG11374

DIOPT Version :10

Sequence 1:NP_054900.2 Gene:LGALSL / 29094 HGNCID:25012 Length:172 Species:Homo sapiens
Sequence 2:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster


Alignment Length:153 Identity:33/153 - (21%)
Similarity:63/153 - (41%) Gaps:21/153 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    31 VYFPRLIVPFCGHI--KGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELK----- 88
            :|.|.|.:||.|.:  :..:..|..:.:.|.|.|.|:.|:|:...|....|...|:....     
  Fly   218 LYQPSLPLPFYGKLLKENFLIEGSSLRIEGRVRLMPQRFSIAFQKGQEIWPQPTVSFYFSPCFLR 282

Human    89 --------AVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLF 145
                    |:.|.|..|....::.......:::.     |...|.:.|.|....:.:||:...||
  Fly   283 SRHDKIGTAIITRRAYLNGDWVNCTVSRLNTSLR-----PGGAFVIVIACRDSYYELFVNNRSLF 342

Human   146 DFYHRIQTLSAIDTIKINGDLQI 168
            .|.::::. ..:|.:.|.||:::
  Fly   343 HFKYQMRP-ECVDIVNIRGDIKL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LGALSLNP_054900.2 Gal-bind_lectin 46..170 CDD:214904 27/136 (20%)
CG11374NP_608488.3 Gal-bind_lectin 42..162 CDD:459768
Gal-bind_lectin 237..367 CDD:459768 27/134 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.