DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP4A and shrb

DIOPT Version :9

Sequence 1:NP_054888.3 Gene:CHMP4A / 29082 HGNCID:20274 Length:222 Species:Homo sapiens
Sequence 2:NP_610462.3 Gene:shrb / 35933 FlyBaseID:FBgn0086656 Length:226 Species:Drosophila melanogaster


Alignment Length:229 Identity:122/229 - (53%)
Similarity:162/229 - (70%) Gaps:14/229 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQA 65
            ||..|::|| ||||..||..||||||:|||.:|||||||||.||:.||..|:|..:||||.||||
  Fly     1 MSFFGKMFG-GKKEVAPTTGEAIQKLRETENMLIKKQEFLEAKIEDELNIARKNASKNKRVALQA 64

Human    66 LRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMT 130
            |::|||.|:||.|.||||||:|.||||:|:|.||..||.||:.||.::|:|:|:||:|||.::|.
  Fly    65 LKKKKRLEKQLQQIDGTLSTIEMQREALESANTNTAVLTTMKNAADALKRAHQNMDVDKVHDMMD 129

Human   131 DITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVP 195
            ||.|||:||::||||||.|:.||.|:|:::|..||:|||||...:|::.:    .||:..||..|
  Fly   130 DIAEQQDVAREISDAISNPVAFGADLDDEDLERELDELEQENFDKEIIGI----PEPTPTLPEAP 190

Human   196 STHLPAGPAPK---------VDEDEEALKQLAEW 220
            :..||.....|         .|:|:..:|||..|
  Fly   191 TEDLPEKAKEKKKATTTTAVEDDDDPDMKQLLSW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP4ANP_054888.3 Intramolecular interaction with C-terminus. /evidence=ECO:0000250 1..150 94/148 (64%)
Interaction with phosphoinosides 1..116 73/114 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 11/19 (58%)
Snf7 21..156 CDD:308778 86/134 (64%)
Intramolecular interaction with N-terminus. /evidence=ECO:0000250 151..222 27/79 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 180..211 9/39 (23%)
shrbNP_610462.3 Snf7 20..193 CDD:281366 102/176 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2777
eggNOG 1 0.900 - - E1_KOG1656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 240 1.000 Inparanoid score I3345
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53573
OrthoDB 1 1.010 - - D1490465at2759
OrthoFinder 1 1.000 - - FOG0001179
OrthoInspector 1 1.000 - - otm42231
orthoMCL 1 0.900 - - OOG6_100985
Panther 1 1.100 - - O PTHR22761
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1365
SonicParanoid 1 1.000 - - X1162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.