DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GRIK5 and Ir7d

DIOPT Version :9

Sequence 1:XP_011525167.1 Gene:GRIK5 / 2901 HGNCID:4583 Length:982 Species:Homo sapiens
Sequence 2:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster


Alignment Length:446 Identity:91/446 - (20%)
Similarity:159/446 - (35%) Gaps:122/446 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   426 PYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVE-DGLYGAPE-PNGSWTGMVGEL 488
            ||:  |.|:::....:..:|....:||.:|..:.|..:|...| :||.|... .||::||.. ::
  Fly   221 PYM--RINWKSSDPMDGLDGLDGLLLRIVARKMNFTLKLIPNEPNGLIGGSSFMNGTFTGAY-KM 282

Human   489 INRQKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSF---LDPFSPAVWLF 550
            :..::|::.:.....|.||...::.:.|:..:.    |.:.:..:.||..:   |.||....||.
  Fly   283 LRERRANITIGCAACTPERSTFLEATSPYSQMS----YIIVLQARGGYSIYEVMLFPFEKYTWLL 343

Human   551 MLLAYLAVSCVL----FLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEI 611
            :       |.:|    .:.:|     |..|.|.|..                             
  Fly   344 L-------STILGLHWIVGSR-----WRMPSPILAG----------------------------- 367

Human   612 MPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQT---NIEYGTIHAG 673
                         |..:..:|.:||.|::..|:    ...||:.:....||.   ...:.|.||.
  Fly   368 -------------WMLWIFVIRASYEASVFNFI----QNSPVKPSPRTLDQALSGGFRFITDHAS 415

Human   674 STMTF----FQNSRYQTYQRMWNYMQSKQP-SVF---VKSTEEGIARVLNSRYAFLLESTMNEYH 730
            ..||.    ||..         ..:.:.|| .||   :|:..:  .....|| |||.:..:.  |
  Fly   416 YRMTLKIPSFQGK---------TLISAGQPVDVFDALLKAPWK--TGAFTSR-AFLADHLVR--H 466

Human   731 RRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQE----NNRLEILKRKWWE------ 785
            |:....|..:...:......:..|.||.|..||...:..::.    .:..:||.   |:      
  Fly   467 RKHRNQLVILAEKIVDNMLCMYFPHGSYFAWEINKLLFNMRSFGIFQHHSQILA---WDNLPTTT 528

Human   786 -----GGRCPKEEDHRAKGLGMENIGGIFIVLIC---GLIIAVFVAVMEFIWSTRR 833
                 |.|.....:..|.|.. |::..:...|.|   .|.|::.|..:|.: |.||
  Fly   529 DTDTPGKRIHSSTESVATGFA-ESMSFVVAALNCLMGALCISIVVFGLELL-SRRR 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GRIK5XP_011525167.1 PBP1_iGluR_Kainate_KA1_2 25..399 CDD:107389
ANF_receptor 42..379 CDD:279440
Periplasmic_Binding_Protein_Type_2 414..785 CDD:304360 76/382 (20%)
Lig_chan 546..816 CDD:278489 55/302 (18%)
Ir7dNP_001138175.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.