DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GRIK5 and Ir92a

DIOPT Version :9

Sequence 1:XP_011525167.1 Gene:GRIK5 / 2901 HGNCID:4583 Length:982 Species:Homo sapiens
Sequence 2:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster


Alignment Length:505 Identity:102/505 - (20%)
Similarity:175/505 - (34%) Gaps:129/505 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   394 NRTLAMNATTLDINLSQTLANKTLVVTTILENPYVMRR----------------PNFQALSGNER 442
            |.|.| |...|..|....|..::|:|.:|...||.:..                || ::|:    
  Fly   225 NETFA-NRVELYPNKLLNLQRRSLLVGSITYVPYTITNYVPAGQGDVDPIHPQWPN-RSLT---- 283

Human   443 FEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGSWTGMVGELINRQKADLAVAAFTITAER 507
            |:|...::::...::.....|:.......:|....|.|..||:|: |..|:.::|:..  |....
  Fly   284 FDGAEANVMKTFCQVHNCHLRVEAYGADNWGGIYDNESSDGMLGD-IYEQRVEMAIGC--IYNWY 345

Human   508 EKVIDFSKPFMTLGISILYRVHMGRK----PGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARL 568
            :.:.:.|.......::||     |..    |.:.:.:.||:...|| :|::.|.: |..||    
  Fly   346 DGITETSHTIARSSVTIL-----GPAPAPLPSWRTNIMPFNNRAWL-VLISTLVI-CGTFL---- 399

Human   569 SPYEWYNPHPCLRARPHILENQY----TLGNSLWFPVGGFMQQGS------EIMPRALSTRCVSG 623
                ::..:...|.|....:.::    .|..|:......|:||.|      ...||......:..
  Fly   400 ----YFMKYVSYRLRYSGTQVKFHHSRKLEKSMLDIFALFIQQPSAPLSFDRFAPRFFLATILCA 460

Human   624 VWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQ 688
                 |:.:.:.|:..|.:.||......||::.:..|                           |
  Fly   461 -----TITLENIYSGQLKSMLTFPFYSAPVDTIEKWA---------------------------Q 493

Human   689 RMWNYMQSKQPSVF----VKS----TEEGIARVLNSR-YAFLLE-STMNEYH---RRLNCNLTQI 740
            ..|.:   ..||:.    |:|    ||:.:||..... |::|.. |.|..|.   .||:.....:
  Fly   494 SGWKW---SAPSIIWVHTVQSSDLETEQILARNFEVHDYSYLSNVSFMPNYGFGIERLSSGSLSV 555

Human   741 GGLLDTKGYGIGMPLGSPFRDEITLA------ILQLQENNRLEILKRK----WWEGGRCPKEED- 794
            |..:.|:.....:.|......:.|.|      ||..:.|..:...:..    .||.....|..| 
  Fly   556 GDYVSTEALENRIVLHDDLYFDYTRAVSIRGWILMPELNKHIRTCQETGLYFHWELEFIDKYMDK 620

Human   795 ------------HRAKG----LGMENIGGIFIVLICGLIIAVFVAVMEFI 828
                        |:.||    |.:.||.|...||..|:..|....|.|.:
  Fly   621 KKQEVLMDLANGHKVKGAPQALDVRNIAGALFVLAFGVAFAGCALVAELL 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GRIK5XP_011525167.1 PBP1_iGluR_Kainate_KA1_2 25..399 CDD:107389 2/4 (50%)
ANF_receptor 42..379 CDD:279440
Periplasmic_Binding_Protein_Type_2 414..785 CDD:304360 78/423 (18%)
Lig_chan 546..816 CDD:278489 63/319 (20%)
Ir92aNP_001097845.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.