Sequence 1: | XP_011525167.1 | Gene: | GRIK5 / 2901 | HGNCID: | 4583 | Length: | 982 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649833.1 | Gene: | Ir85a / 41052 | FlyBaseID: | FBgn0037630 | Length: | 605 | Species: | Drosophila melanogaster |
Alignment Length: | 337 | Identity: | 70/337 - (20%) |
---|---|---|---|
Similarity: | 113/337 - (33%) | Gaps: | 98/337 - (29%) |
- Green bases have known domain annotations that are detailed below.
Human 24 LRMAAILDD--------QTVCGRGERLALALAREQING--------------------IIEVPAK 60
Human 61 ARVEV---------DIFELQRDSQY-ETTDTMCQILPKG---------------------VVSVL 94
Human 95 GPS------SSPASASTVSHICGEKEIPHIKVGPEETPRL-----QYLRFASVSLYPSNEDVSLA 148
Human 149 VSRILKSFNYPSASLICAKAECLLRLEEL--VRGFLISKETLSVRMLDDSRDPTPLLKEIRDDKV 211
Human 212 STIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDG----------IVEDSSNILG 266
Human 267 F--SMFNTSHPF 276 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GRIK5 | XP_011525167.1 | PBP1_iGluR_Kainate_KA1_2 | 25..399 | CDD:107389 | 69/336 (21%) |
ANF_receptor | 42..379 | CDD:279440 | 63/311 (20%) | ||
Periplasmic_Binding_Protein_Type_2 | 414..785 | CDD:304360 | |||
Lig_chan | 546..816 | CDD:278489 | |||
Ir85a | NP_649833.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165156216 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |