DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GRIK5 and Ir85a

DIOPT Version :9

Sequence 1:XP_011525167.1 Gene:GRIK5 / 2901 HGNCID:4583 Length:982 Species:Homo sapiens
Sequence 2:NP_649833.1 Gene:Ir85a / 41052 FlyBaseID:FBgn0037630 Length:605 Species:Drosophila melanogaster


Alignment Length:337 Identity:70/337 - (20%)
Similarity:113/337 - (33%) Gaps:98/337 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    24 LRMAAILDD--------QTVCGRGERLALALAREQING--------------------IIEVPAK 60
            |||....||        .|:.|....|| |...|::|.                    .:|| ||
  Fly   206 LRMCIYKDDVRAIFWRQGTILGTDGLLA-AYVAERLNATMMITRPHSYNNHNLSSDICFLEV-AK 268

Human    61 ARVEV---------DIFELQRDSQY-ETTDTMCQILPKG---------------------VVSVL 94
            ..|:|         |.|..|.:|.. .|.|.:|.|:||.                     :||||
  Fly   269 EYVDVAMNIRFLVPDTFRKQAESTVSHTRDDLCVIVPKAKTAPTFWNIFRSFGSLVWALILVSVL 333

Human    95 GPS------SSPASASTVSHICGEKEIPHIKVGPEETPRL-----QYLRFASVSLYPSNEDVSLA 148
            ..:      .|......:....|...:|..::.|..:.||     .|......|.:..|....:.
  Fly   334 VANVFCYILKSEVGRVPMQLFAGALTMPMTQIPPNHSIRLFLIFWLYFGLLICSAFKGNLTSMMV 398

Human   149 VSRILKSFNYPSASLICAKAECLLRLEEL--VRGFLISKETLSVRMLDDSRDPTPLLKEIRDDKV 211
            ....|...|...| |..:....::|...:  ::.||    ||..:  .:||....:| |:.|.::
  Fly   399 FQPYLPDINQLGA-LARSHYHIIIRPRHVKHIQHFL----TLGHK--HESRIREQML-EVSDTQM 455

Human   212 STIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDG----------IVEDSSNILG 266
            ..::.:.:...::|.....:...:.|..:.:    :..|:.||..          ||...|..||
  Fly   456 YEMMRNNDIRFAYLEKYHIARFQVNSRVHMH----LGRPLFHLMNSCLVPFHAVYIVPYGSPYLG 516

Human   267 F--SMFNTSHPF 276
            |  |:..:||.|
  Fly   517 FLDSLIRSSHEF 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GRIK5XP_011525167.1 PBP1_iGluR_Kainate_KA1_2 25..399 CDD:107389 69/336 (21%)
ANF_receptor 42..379 CDD:279440 63/311 (20%)
Periplasmic_Binding_Protein_Type_2 414..785 CDD:304360
Lig_chan 546..816 CDD:278489
Ir85aNP_649833.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156216
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.