DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GRIK5 and Ir76b

DIOPT Version :9

Sequence 1:XP_011525167.1 Gene:GRIK5 / 2901 HGNCID:4583 Length:982 Species:Homo sapiens
Sequence 2:NP_649176.1 Gene:Ir76b / 40198 FlyBaseID:FBgn0036937 Length:636 Species:Drosophila melanogaster


Alignment Length:510 Identity:117/510 - (22%)
Similarity:198/510 - (38%) Gaps:78/510 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   374 TLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVTTILENPYVMRRPNFQALS 438
            ||..:.:.:...||:..|...:.|.: ||..|..||         .|.:|||             
  Fly    62 TLETINRKKPKLREMLDWIGGKHLRI-ATLEDFPLS---------YTEVLEN------------- 103

Human   439 GNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGSWTGMVGELINRQKADLAVAAFTI 503
            |.....|....::..|.:...|.|.:.:.:|.:.|:|   ..:...:.|::|....|||.|....
  Fly   104 GTRVGHGVSFQIIDFLKKKFNFTYEVVVPQDNIIGSP---SDFDRSLIEMVNSSTVDLAAAFIPS 165

Human   504 TAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLF----L 564
            .:::...:.:|...:..|..|:..............|.||...||:.:|::.|||..:::    |
  Fly   166 LSDQRSFVYYSTTTLDEGEWIMVMQRPRESASGSGLLAPFEFWVWILILVSLLAVGPIIYALIIL 230

Human   565 AARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFT 629
            ..||:......|              |:||:..||..|..|:|||.:.|.|.|||.:...||.|.
  Fly   231 RNRLTGDGQQTP--------------YSLGHCAWFVYGALMKQGSTLSPIADSTRLLFATWWIFI 281

Human   630 LIIISSYTANLAAFLTVQRMEVPVESADDLADQT---------NIEYGTIHAGSTMTF------- 678
            .|:.|.|||||.||||:.:..:|..:.:|:..:.         .:||.......:::.       
  Fly   282 TILTSFYTANLTAFLTLSKFTLPYNTVNDILTKNKHFVSMRGGGVEYAIRTTNESLSMLNRMIQN 346

Human   679 ----FQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQ 739
                |.:....|| .:.||:: |...|||:. ...|..:|...|  |...|::....:::|....
  Fly   347 NYAVFSDETNDTY-NLQNYVE-KNGYVFVRD-RPAINIMLYRDY--LYRKTVSFSDEKVHCPFAM 406

Human   740 IGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEIL-KRKWWEGGRCPKEEDHRAKGLGME 803
            .......|......|:||.........:|.|.|:..::.| ||.......||::.....:.|...
  Fly   407 AKEPFLKKKRTFAYPIGSNLSQLFDPELLHLVESGIVKHLSKRNLPSAEICPQDLGGTERQLRNG 471

Human   804 NIGGIFIVLICGLIIAVFVAVMEFIWSTRRSAESEETPALHPAACQCSALGPRTP 858
            ::...:.:::.|...|:.|...|.::....|.:.....|.|       .:| |||
  Fly   472 DLMMTYYIMLAGFATALAVFSTELMFRYVNSRQEANKWARH-------GIG-RTP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GRIK5XP_011525167.1 PBP1_iGluR_Kainate_KA1_2 25..399 CDD:107389 6/24 (25%)
ANF_receptor 42..379 CDD:279440 2/4 (50%)
Periplasmic_Binding_Protein_Type_2 414..785 CDD:304360 92/395 (23%)
Lig_chan 546..816 CDD:278489 71/294 (24%)
Ir76bNP_649176.1 Periplasmic_Binding_Protein_Type_2 83..437 CDD:304360 93/398 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.