DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GRIK5 and Ir76a

DIOPT Version :9

Sequence 1:XP_011525167.1 Gene:GRIK5 / 2901 HGNCID:4583 Length:982 Species:Homo sapiens
Sequence 2:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster


Alignment Length:683 Identity:122/683 - (17%)
Similarity:206/683 - (30%) Gaps:256/683 - (37%)


- Green bases have known domain annotations that are detailed below.


Human   323 RSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTGRVEFNSKGQRTN-YTLRILEKSRQGHR 386
            |.:.:...||.....:.|.:.:....|...::.|      ||..||...| :|||:.....:.|.
  Fly    40 RLETVHPMPLIIMDWHRWANRSDQDVYDYKIKED------EFEGKGIPYNDWTLRLTVAIERSHC 98

Human   387 E---------------------IGVWYSNRTLAMNATTLD---------------------INLS 409
            |                     ..:|.|.|...|...|.:                     :..|
  Fly    99 ETFIAFQEQIPEFARYFYHASIYSIWRSLRNRFMFVYTKEFEDKKDSYLSGYIFQDQPNILVITS 163

Human   410 QTLANKTLVVTT--------ILENP-----YVMRRPNFQA-------------------LSGNE- 441
            |.|.:.|..:.|        ..:||     |:::|  |.|                   |.|.| 
  Fly   164 QYLNSSTFEIKTNRFVGPRNFNKNPEPVEFYILQR--FDAKGTKATWETQSAMSSKMRNLKGREV 226

Human   442 -----------------------RF--------EGFCVDMLRELAELLRFRYRLRLVEDGLYGAP 475
                                   ||        :|..:.::....||.....::...|...:|..
  Fly   227 VIGIFDYKPFMLLDYEKPPLYYDRFMNTTDVTIDGTDIQLMLIFCELYNCTIQVDTSEPYDWGDI 291

Human   476 EPNGSWTGMVGELINRQKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL 540
            ..|.|..|:||.:::|:. |..|....:..|..:.:|.:......|::.|... ..|...:...|
  Fly   292 YLNASGYGLVGMILDRRN-DYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPA-PNRLISWTLLL 354

Human   541 DPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWF------ 599
            .||...:|:.::|..|..|..|.:..|     |  .|..:.|           ||| |.      
  Fly   355 RPFQFVLWMCVMLCLLLESLALGITRR-----W--EHSSVAA-----------GNS-WISSLRFG 400

Human   600 ---PVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLAD 661
               .:..|:.|.:..:..:.:.|.|....:...:|:.:.|:..|||.||:..:|...:|...|.|
  Fly   401 CISTLKLFVNQSTNYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILTLPTLEEAADSRQRLFD 465

Human   662 QTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFLLESTM 726
            ...|..||..|..|                                     .::.|.|..:...:
  Fly   466 HKLIWTGTSQAWIT-------------------------------------TIDERSADPVLLGL 493

Human   727 NEYHRRLNCNL-------TQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILK---- 780
            .|::|..:.||       .|:|.:::...:|   .||:          .:|.||:.|:.||    
  Fly   494 MEHYRVYDANLISAFSHTEQMGFVVERLQFG---HLGN----------TELIENDALKRLKLMVD 545

Human   781 ------------RKW------------WEGGRCPK----------EEDHRAK------------- 798
                        |.|            |......|          ...||..             
  Fly   546 DIYFAFTVAFVPRLWPHLNAYNDFILAWHSSGFDKFWEWKIAAEYMNAHRQNRIVASEKTNLDIG 610

Human   799 --GLGMENIGGIFIVLICGLIIAVFVAVMEFIW 829
              .||::|..|:.::...|:|.::...:.| :|
  Fly   611 PVKLGIDNFIGLILLWCFGMICSLLTFLGE-LW 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GRIK5XP_011525167.1 PBP1_iGluR_Kainate_KA1_2 25..399 CDD:107389 19/97 (20%)
ANF_receptor 42..379 CDD:279440 14/56 (25%)
Periplasmic_Binding_Protein_Type_2 414..785 CDD:304360 86/478 (18%)
Lig_chan 546..816 CDD:278489 60/338 (18%)
Ir76aNP_001097647.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156218
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.