DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GRIK5 and Ir68b

DIOPT Version :9

Sequence 1:XP_011525167.1 Gene:GRIK5 / 2901 HGNCID:4583 Length:982 Species:Homo sapiens
Sequence 2:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster


Alignment Length:391 Identity:81/391 - (20%)
Similarity:136/391 - (34%) Gaps:104/391 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   438 SGNERFEGFCVDMLRELAELLRFRYRLRLVEDG-LYGAPEPNGSWTGMVGELINRQKADLAVAAF 501
            :|.:..:|...   |.:.|:|.........||. .||...|||::||:|.::         |...
  Fly   213 AGYQAVDGVAA---RVVGEMLNASVTYVFPEDNESYGRCLPNGNYTGVVSDI---------VGGH 265

Human   502 TITAEREK-VIDFSKPFMTLGISILY-----RVHM-----GRKPGYFSFLDPFSPAVWLFMLLAY 555
            |..|...: |:|...|    .:.:||     .:|:     ..:|.|..|:..|...||..:|:..
  Fly   266 THFAPNSRFVLDCIWP----AVEVLYPYTRRNLHLVVPASAIQPEYLIFVRVFRRTVWYLLLVTL 326

Human   556 LAVSCVLFLAARLSPYEWYNPHPCLRARPH--ILENQYTLGNSLWFPV------------GGFMQ 606
            |.|..|.::..||.           |..|.  :::.|.|     |:.:            .|.:.
  Fly   327 LVVVLVFWVMQRLQ-----------RRIPRRGVIQFQAT-----WYEILEMFGKTHVGEPAGRLS 375

Human   607 QGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIH 671
            ..|       |.|.....|..|:.::.:.|.|.|.:.......|..|:..|||.      :..:|
  Fly   376 SFS-------SMRTFLMGWILFSYVLSTIYFAKLESGFVRPSYEEQVDRVDDLV------HLDVH 427

Human   672 AGSTMTFFQNSRYQTYQRMWNYMQSKQ---PSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRL 733
            ..:..|.:...|....:..:..::::.   |.....|..:.:.|..:.|.||:    |.::|.|.
  Fly   428 IYAVTTMYDAVRSALTEHQYGLLENRSRQLPLGIATSYYQPVVRRRDRRAAFI----MRDFHARD 488

Human   734 NCNLTQIGGLLDTKGYGIG------------MPLGSPFRDEITLAILQLQENNRLEILKRKWWEG 786
            ...:| .....:...|.|.            :|.||||.             :|||.|...:.|.
  Fly   489 FLAIT-YDSQAERPAYHIAREYLRSMICTYILPRGSPFL-------------HRLESLYSGFLEH 539

Human   787 G 787
            |
  Fly   540 G 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GRIK5XP_011525167.1 PBP1_iGluR_Kainate_KA1_2 25..399 CDD:107389
ANF_receptor 42..379 CDD:279440
Periplasmic_Binding_Protein_Type_2 414..785 CDD:304360 79/387 (20%)
Lig_chan 546..816 CDD:278489 53/271 (20%)
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 47/255 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156287
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.