DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GRIK5 and Ir7g

DIOPT Version :9

Sequence 1:XP_011525167.1 Gene:GRIK5 / 2901 HGNCID:4583 Length:982 Species:Homo sapiens
Sequence 2:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster


Alignment Length:572 Identity:111/572 - (19%)
Similarity:195/572 - (34%) Gaps:189/572 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   337 ANIWPHGTSLMNYLRMVEYDGLTGRVEFN----------SKGQRTNYTLRILEKSRQGHREIGVW 391
            |..|.|  .|:|...|.:..|  |:|..:          :..|.|...:.:.|..:  ||:   :
  Fly   146 AYCWRH--QLINCNVMTQSSG--GQVLLHTYFPYAPGQCNDSQPTRINMFLGESWK--HRD---Y 201

Human   392 YSNRTLAMNATTLDINLSQTLANKTLVVTTILENPYVMRRPNFQALSGNERFEGFCVDMLRELAE 456
            :.::...:|...|.:     ||.|.              .|......|.....|....:|:||:.
  Fly   202 FPSKLHNLNGCPLIV-----LARKV--------------SPFLDLDEGQRELRGLEGRLLQELSR 247

Human   457 LLRFRYRLRLVEDGLYGAPEPNGSWT--GMVGELINRQKADLAVAAFTITAEREKVIDFSK---- 515
            .:.|..:...::|.|    :...:||  .::.:|:..:.|.||:...      .|.|.::.    
  Fly   248 RMNFSIQFSGLQDQL----KNRTTWTEKQLLQKLVQERIAHLAIGYV------RKRIQYATNLTP 302

Human   516 --PFMTLGI--SILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAAR--------- 567
              |..:..:  .:|...|.......:||  ||....|:.::.::|::||:..|. |         
  Fly   303 VFPHYSNRVVGCLLLNAHNLTSLEIWSF--PFQALTWICLVFSFLSISCLALLHXRGAGDRLALV 365

Human   568 LSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLII 632
            |:.|                      ..||..|:.         .|...|.:.:...|..|.||:
  Fly   366 LAVY----------------------AASLGLPID---------PPERPSLQLLFASWLIFGLIV 399

Human   633 ISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSK 697
            .|.|:|.|...|   |..:......:|.|.|:.:|..:...:|:   |:.|         .:.|.
  Fly   400 RSMYSALLFFIL---RYHLHQRLPGNLQDLTHGDYAAVMGRTTL---QDLR---------EVPSL 449

Human   698 QPSVFVKST------EEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQIGGL------------- 743
            |..:.:||.      ||.:.|.|:                  .|.|.:..|.             
  Fly   450 QDLLGLKSVIVTSEREEEVLRTLD------------------RCTLREGAGSHPLFFGLISQDAL 496

Human   744 --LDTKGYGIG----MPLGSPFRD--EITLAILQLQENNRLEI-------------LKRKWWEGG 787
              |..:|:..|    :|     :|  |..||| .||:::.|..             |...|  .|
  Fly   497 LHLTQRGHRAGAYHIIP-----QDVLEQQLAI-YLQKHSHLASHLDHLVMSIRSVGLVHHW--AG 553

Human   788 RCPKEEDHRAKGLGME------NIGGIFIVLICGL-IIAVFVAVMEFIWSTR 832
            :...|...|::.|..|      ::..::| |..|| ::::.|.:.|.:.|.|
  Fly   554 QMASERYFRSRFLYREKRIRQPDLWAVYI-LTAGLYLLSLVVFICELLASRR 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GRIK5XP_011525167.1 PBP1_iGluR_Kainate_KA1_2 25..399 CDD:107389 14/71 (20%)
ANF_receptor 42..379 CDD:279440 11/51 (22%)
Periplasmic_Binding_Protein_Type_2 414..785 CDD:304360 80/429 (19%)
Lig_chan 546..816 CDD:278489 62/324 (19%)
Ir7gNP_001368933.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.