DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GRIK5 and Ir41a

DIOPT Version :9

Sequence 1:XP_011525167.1 Gene:GRIK5 / 2901 HGNCID:4583 Length:982 Species:Homo sapiens
Sequence 2:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster


Alignment Length:474 Identity:103/474 - (21%)
Similarity:166/474 - (35%) Gaps:105/474 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   412 LANKTLVVTTILENPYVMRRPNF------QALSGNERFEGFCVDMLRELAELLRF--RYRLRLVE 468
            |..:.:::......||.:.:.|.      ..:||...|:...:|. .|...:|.|  ::...:..
  Fly   208 LQGREVIIAGFDYPPYTVIKHNMSTNAQDMGVSGESDFKNVYIDG-TETRIVLNFCEQFNCTIQI 271

Human   469 DGL----YGAPEPNGSWTGMVGELINRQKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVH 529
            |..    :|...||.|..|.:|.|||| |||:.:.|.....|....:|.|...:..||:.|....
  Fly   272 DSSAANDWGKVYPNMSGDGALGMLINR-KADICIGAMYSWYEDYTYLDLSMYLVRSGITCLVPAP 335

Human   530 MGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYT-- 592
            : |...::..|:||...:|..:||...|.:..|.||        |.....|...|...|..:|  
  Fly   336 L-RLTSWYLPLEPFKETLWAAILLCLCAEATGLVLA--------YKSEQALYVLPGYREGWWTCT 391

Human   593 -LGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESA 656
             .|....|.:  |:.|.......:|:.|.:....:...|||.|.|...||:.||:..|:   |:|
  Fly   392 SFGVCTTFKL--FISQSGNSKAYSLTVRVLLFACFLNDLIITSIYGGGLASILTIPSMD---EAA 451

Human   657 DDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAF- 720
            |                 |:|     |.:.::..|........|....|.|..:..:|.:.:.: 
  Fly   452 D-----------------TVT-----RLRFHRLQWAANSEAWVSAIRASDEALVKDILYNFHIYS 494

Human   721 ---LLESTMNEYHRRLNCNLTQIGGLLDTKGYG---IGMPLGSPFRDEITLAILQLQENNRLEIL 779
               ||....:::.|        ||..::...:|   ||..||....|::.:....:.....:..:
  Fly   495 DDELLRLAQDQHMR--------IGFTVERLPFGHFAIGNYLGPQAIDQLVIMKDDIYFQYTVAFV 551

Human   780 KRKW------------WEGGRCPKEEDHRAKG-------------------------LGMENIGG 807
            .|.|            |......|..::|...                         |||.|..|
  Fly   552 PRLWPLLDKLNTLIYSWHSSGFDKYWEYRVVADNLNLKIQQQVQETMTGTKDIGPVPLGMSNFAG 616

Human   808 IFIVLICGLIIAVFVAVME 826
            ..||.|.|..||....::|
  Fly   617 FIIVWILGSAIATLTFLLE 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GRIK5XP_011525167.1 PBP1_iGluR_Kainate_KA1_2 25..399 CDD:107389
ANF_receptor 42..379 CDD:279440
Periplasmic_Binding_Protein_Type_2 414..785 CDD:304360 87/404 (22%)
Lig_chan 546..816 CDD:278489 63/316 (20%)
Ir41aNP_995744.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.