DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLF15 and sr

DIOPT Version :9

Sequence 1:XP_011511045.1 Gene:KLF15 / 28999 HGNCID:14536 Length:435 Species:Homo sapiens
Sequence 2:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster


Alignment Length:401 Identity:96/401 - (23%)
Similarity:138/401 - (34%) Gaps:136/401 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   115 IGASSGPVAWGPWRRAAAPVKGEHFCLPEFPLGDPDDVPRP----FQPTLEEIEEFLEENMEPGV 175
            :|..:||:         :|        |...||:...:|.|    |||.|..:........:...
  Fly   759 LGVLAGPM---------SP--------PSNSLGNSWGLPSPDKTMFQPPLFSLPAHYATMQQQQQ 806

Human   176 KEVPEGNSKDLDACSQLSAGPHKSHLHPGSSGRERCS----------------------PPP--G 216
            ::..:...:.    .|.:||...|   |...||...:                      |||  .
  Fly   807 QQQQQQQQQQ----QQQAAGAAPS---PYDDGRAAAAAAAQHAELLGLTMDCTPLLLKQPPPSYA 864

Human   217 GASAGGAQGPGGGPTPDGPIPVLLQIQPV--PVKQESGTGPASPGQAPENVKVAQLLVNIQGQTF 279
            |||||   .||.|.........|.|.|.|  ..|.:....||...|..:.|:..|.... |.||.
  Fly   865 GASAG---FPGLGDLHSSHEQQLQQQQYVRSQPKYQWLDSPADYAQQQQQVQQVQQQQQ-QQQTL 925

Human   280 AL-----------------------VPQVVPSSN------------------------------- 290
            .|                       .|.:.||||                               
  Fly   926 VLPGPTSSASSSNAALGVLIPKQENYPDMQPSSNGTGYSGGSGGSSAAAAAAAAAAAAAVQLAEY 990

Human   291 -------LNLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELI--KMHKCTFPG 346
                   ..:.|:..:.:.||:...||             ..:|:|..|:...:  :.:.|....
  Fly   991 SPSTSKGHEILSQVYQQSTVPLKLVPV-------------KPRKYPNRPSKTPVHERPYACPVEN 1042

Human   347 CSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFAR 411
            |.:.:::|..|..|:|.|||:|||.|..  |...|||||.|:.|.|:|:|.||:.|.:|.:||||
  Fly  1043 CDRRFSRSDELTRHIRIHTGQKPFQCRI--CMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFAR 1105

Human   412 SDHLSKHIKVH 422
            ||...:|.|||
  Fly  1106 SDEKKRHAKVH 1116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLF15XP_011511045.1 zf-C2H2 340..364 CDD:278523 6/23 (26%)
zf-C2H2_8 342..421 CDD:292531 35/78 (45%)
C2H2 Zn finger 342..364 CDD:275368 6/21 (29%)
zf-H2C2_2 356..383 CDD:290200 12/26 (46%)
C2H2 Zn finger 372..394 CDD:275368 10/21 (48%)
zf-H2C2_2 386..411 CDD:290200 11/24 (46%)
C2H2 Zn finger 402..422 CDD:275368 10/19 (53%)
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 6/23 (26%)
C2H2 Zn finger 1038..1060 CDD:275368 6/21 (29%)
zf-H2C2_2 1052..1077 CDD:290200 12/26 (46%)
C2H2 Zn finger 1068..1088 CDD:275368 10/21 (48%)
zf-H2C2_2 1080..1105 CDD:290200 11/24 (46%)
C2H2 Zn finger 1096..1116 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.