Sequence 1: | XP_011511045.1 | Gene: | KLF15 / 28999 | HGNCID: | 14536 | Length: | 435 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611861.1 | Gene: | CG3065 / 37818 | FlyBaseID: | FBgn0034946 | Length: | 400 | Species: | Drosophila melanogaster |
Alignment Length: | 225 | Identity: | 74/225 - (32%) |
---|---|---|---|
Similarity: | 109/225 - (48%) | Gaps: | 42/225 - (18%) |
- Green bases have known domain annotations that are detailed below.
Human 232 PDGPIPVLLQIQ-PV-PVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLP 294
Human 295 SKFVRIAPVP---IAAKPV--------GSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPGCS 348
Human 349 KMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSD 413
Human 414 HLSKHIKVH-----------RFPRSSRSVR 432 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
KLF15 | XP_011511045.1 | zf-C2H2 | 340..364 | CDD:278523 | 11/23 (48%) |
zf-C2H2_8 | 342..421 | CDD:292531 | 46/78 (59%) | ||
C2H2 Zn finger | 342..364 | CDD:275368 | 11/21 (52%) | ||
zf-H2C2_2 | 356..383 | CDD:290200 | 15/26 (58%) | ||
C2H2 Zn finger | 372..394 | CDD:275368 | 13/21 (62%) | ||
zf-H2C2_2 | 386..411 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 402..422 | CDD:275368 | 12/19 (63%) | ||
CG3065 | NP_611861.1 | COG5048 | 99..>400 | CDD:227381 | 53/118 (45%) |
C2H2 Zn finger | 111..133 | CDD:275368 | 11/21 (52%) | ||
zf-C2H2 | 139..163 | CDD:278523 | 14/23 (61%) | ||
C2H2 Zn finger | 141..163 | CDD:275368 | 13/21 (62%) | ||
zf-H2C2_2 | 155..180 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 171..191 | CDD:275368 | 12/19 (63%) | ||
zf-C2H2 | 346..368 | CDD:278523 | |||
C2H2 Zn finger | 348..368 | CDD:275368 | |||
zf-H2C2_2 | 360..385 | CDD:290200 | |||
C2H2 Zn finger | 376..396 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.870 |