DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLF15 and odd

DIOPT Version :9

Sequence 1:XP_011511045.1 Gene:KLF15 / 28999 HGNCID:14536 Length:435 Species:Homo sapiens
Sequence 2:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster


Alignment Length:146 Identity:49/146 - (33%)
Similarity:65/146 - (44%) Gaps:37/146 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   317 PGPAGL------LMGQKFPKNPAAEL-------------------IKMHKCTFPGCSKMYTKSSH 356
            |.||||      :||:.|...|..:|                   .|...|.:  |::.:|||.:
  Fly   172 PYPAGLHSLHAAVMGRHFGAMPTLKLGGAGGASGVPSGATGSSRPKKQFICKY--CNRQFTKSYN 234

Human   357 LKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKV 421
            |..|.|.||.|:|::|..  ||..|.|.|.|..||..||..||::|..|.|.|.:|..|:.| ||
  Fly   235 LLIHERTHTDERPYSCDI--CGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVH-KV 296

Human   422 -------HRFPRSSRS 430
                   |:.|...||
  Fly   297 THLEEGPHKCPICQRS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLF15XP_011511045.1 zf-C2H2 340..364 CDD:278523 8/23 (35%)
zf-C2H2_8 342..421 CDD:292531 32/78 (41%)
C2H2 Zn finger 342..364 CDD:275368 8/21 (38%)
zf-H2C2_2 356..383 CDD:290200 11/26 (42%)
C2H2 Zn finger 372..394 CDD:275368 9/21 (43%)
zf-H2C2_2 386..411 CDD:290200 11/24 (46%)
C2H2 Zn finger 402..422 CDD:275368 9/26 (35%)
oddNP_722922.1 COG5048 <203..334 CDD:227381 39/115 (34%)
C2H2 Zn finger 222..242 CDD:275368 8/21 (38%)
zf-H2C2_2 234..259 CDD:290200 11/26 (42%)
C2H2 Zn finger 250..270 CDD:275368 9/21 (43%)
zf-H2C2_2 262..285 CDD:290200 10/22 (45%)
C2H2 Zn finger 278..298 CDD:275368 9/20 (45%)
zf-C2H2 304..326 CDD:278523 4/9 (44%)
C2H2 Zn finger 306..326 CDD:275368 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.