DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRPL13 and mRpL13

DIOPT Version :9

Sequence 1:NP_054797.2 Gene:MRPL13 / 28998 HGNCID:14278 Length:178 Species:Homo sapiens
Sequence 2:NP_523598.2 Gene:mRpL13 / 35145 FlyBaseID:FBgn0032720 Length:178 Species:Drosophila melanogaster


Alignment Length:176 Identity:83/176 - (47%)
Similarity:117/176 - (66%) Gaps:0/176 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     3 SFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAF 67
            |.::..||||||||.|::.|...|.|.:.|.:....|.||.||:||.::|||||||::|||.||.
  Fly     2 SIAKRVQQWATFARTWHIYDCTWQNPFESAKLVKTHLLGLQKPIYHPMNDCGDHVVLINTREIAL 66

Human    68 SGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEY 132
            .|::|.::||..|||||||.....|.|||.:||..::|.|:|..:..||.||..|:|||||.|:.
  Fly    67 PGDEWVKRVYFHHTGYPGGASWTLAWQLHEKDPTMVMKKAVYNSMRGNLQRRHTMQRLHLFADDQ 131

Human   133 IPEDILKNLVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL 178
            :||:||:|:..::..||.||:|||...:|.::.||.:...|:||.|
  Fly   132 VPEEILQNVTNQIRTPRSIPQRLDHIDKETLENFPNIMDYPKDYIL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPL13NP_054797.2 Ribosomal_L13 16..134 CDD:395454 56/117 (48%)
mRpL13NP_523598.2 Ribosomal_L13 16..141 CDD:278969 60/124 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147256
Domainoid 1 1.000 134 1.000 Domainoid score I5055
eggNOG 1 0.900 - - E1_COG0102
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90894
Inparanoid 1 1.050 185 1.000 Inparanoid score I3968
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62551
OrthoDB 1 1.010 - - D1119705at2759
OrthoFinder 1 1.000 - - FOG0003171
OrthoInspector 1 1.000 - - oto89744
orthoMCL 1 0.900 - - OOG6_101118
Panther 1 1.100 - - LDO PTHR11545
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4169
SonicParanoid 1 1.000 - - X3602
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.