DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGEH1 and MAGE

DIOPT Version :9

Sequence 1:NP_054780.2 Gene:MAGEH1 / 28986 HGNCID:24092 Length:219 Species:Homo sapiens
Sequence 2:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster


Alignment Length:178 Identity:49/178 - (27%)
Similarity:85/178 - (47%) Gaps:32/178 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    27 ASEASE----TPMAASVVASTPEDDLSGPEEDPSTPEEAST-----TPEEASSTAQAQKPSVPRS 82
            |.:.||    .|:..:::|.|....|        ||.:|:|     |.||..::.....|:    
  Fly    56 AGDKSELKKRLPLVTNLLAETFGIIL--------TPLDATTKTFICTAEEPVASIHELTPA---- 108

Human    83 NFQGTKKSLLMSILALIFIMGNSAKEALVWKVLGKLGMQPGRQHSIFG-DPKKIVTEEFVRRGYL 146
              |..:.:||..||..||:.||..:::.::.:|..|.:.|..:|..|| :.:|.:.|.||::.||
  Fly   109 --QRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYL 171

Human   147 IYKPVPRSSPVEYE-----FFWGPRAHVESSKLKVMHFVARVRNRCSK 189
            ..:   ||....|:     |.|||||..|.:..:::.|.:::.|:..|
  Fly   172 KRE---RSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGEH1NP_054780.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..84 15/65 (23%)
MAGE <62..173 CDD:396164 36/121 (30%)
MAGENP_649702.2 MAGE 36..201 CDD:279759 46/161 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151977
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.