DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACAD9 and Arc42

DIOPT Version :9

Sequence 1:NP_054768.2 Gene:ACAD9 / 28976 HGNCID:21497 Length:621 Species:Homo sapiens
Sequence 2:NP_650840.1 Gene:Arc42 / 42364 FlyBaseID:FBgn0038742 Length:405 Species:Drosophila melanogaster


Alignment Length:387 Identity:147/387 - (37%)
Similarity:220/387 - (56%) Gaps:22/387 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    60 SQDELNEINQFL-GPVEKFFTEEV--DSRKIDQEGKIPDETLEKLKSLGLFGLQVPEEYGGLGFS 121
            |...|:|.:|.| .....|...|:  ::.|.|:|...|::.:.::..||:..:.:|||.||.|..
  Fly    23 SLSALSETHQMLQKSCRDFANNELSGNAAKFDREHLYPEKQIRQMGELGVMAVAIPEELGGTGLD 87

Human   122 NTMYSRLGEIISMD-GSITVTLAAHQAIGLKGIILAGTEEQKAKYLPKLASGEHIAAFCLTEPAS 185
            ...|:...|.||.. .|..|.::.:.::.|..::..|.:.||..|:....:||.:..|.|:||.:
  Fly    88 YVAYAIAMEEISRGCASAGVIMSVNNSLYLGPLLSFGNDAQKKDYITPFTTGERVGCFALSEPGN 152

Human   186 GSDAASIRSRATLSEDK-KHYILNGSKVWITNGGLANIFTVFAKTEVVDSDGSVKDK-ITAFIVE 248
            ||||.   :.:|::.|| .|::|||:|.||||...|....|||.|     :..:|.| |:||||.
  Fly   153 GSDAG---AASTIATDKGDHFVLNGTKAWITNAFEAEAAIVFATT-----NKQLKHKGISAFIVP 209

Human   249 RDFGGVTNGKPEDKLGIRGSNTCEVHFENTKIPVENILGEVGDGFKVAMNILNSGRFSMGSVVAG 313
            :...|.:.||.|||||||||:||::.||:..:|.||:|||.|.|||:||..|::||..:.....|
  Fly   210 KATKGFSLGKKEDKLGIRGSSTCQLIFEDCVVPKENMLGEPGFGFKIAMQTLDAGRIGIAGQALG 274

Human   314 LLKRLIEMTAEYACTRKQFNKRLSEFGLIQEKFALMAQKAYVMES---MTYLTAGMLDQPGFPDC 375
            :.:..:|:..:||..|:.|.|.:::...||:|.|.|   :..|||   :|:..|.:.||.  ...
  Fly   275 IGQAALELAVDYAQKRQAFGKPIAKLQSIQQKIADM---SLAMESARLLTWRAAWLKDQK--QPY 334

Human   376 SIEAAMVKVFSSEAAWQCVSEALQILGGLGYTRDYPYERILRDTRILLIFEGTNEILRMYIA 437
            :.||||.|:.:||||..|..:.:|||||:||..|...||..||.||..|:|||:||.|:.||
  Fly   335 TKEAAMAKLAASEAATLCSHQCIQILGGMGYVTDMAAERHYRDARITEIYEGTSEIQRLVIA 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACAD9NP_054768.2 VLCAD 38..445 CDD:173850 147/387 (38%)
Arc42NP_650840.1 CaiA 27..405 CDD:224871 146/383 (38%)
SCAD_SBCAD 29..401 CDD:173847 145/381 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.