DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACAD9 and CG6638

DIOPT Version :9

Sequence 1:NP_054768.2 Gene:ACAD9 / 28976 HGNCID:21497 Length:621 Species:Homo sapiens
Sequence 2:NP_648239.1 Gene:CG6638 / 38979 FlyBaseID:FBgn0035911 Length:420 Species:Drosophila melanogaster


Alignment Length:390 Identity:147/390 - (37%)
Similarity:209/390 - (53%) Gaps:34/390 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    64 LNEINQFLGPVE-KFFTEEVD--SRKIDQEGKIPD--ETLEKLKSLGLFGLQVPEEYGGLGFSNT 123
            |:|..|.|..|. .||.:|:.  :::||:.....|  ...:||.:||..|:....::||.|    
  Fly    39 LDEDRQKLREVAFNFFQKELAPLAKEIDKLDNFKDMRPFWKKLGALGFLGITAEPDFGGTG---- 99

Human   124 MYSRLGEIISMD------GSITVTLAAHQAIGLKGIILAGTEEQKAKYLPKLASGEHIAAFCLTE 182
             .|.|...|.|:      |.:.::..||..:.:..:...||.|||.||||||.||||:....::|
  Fly   100 -GSYLDHCIIMEEFSRAAGGVALSYGAHSNLCINQLTKNGTPEQKEKYLPKLCSGEHVGGLAMSE 163

Human   183 PASGSDAASIRSRATLSEDKKHYILNGSKVWITNGGLANIFTVFAKTEVVDSDGSVKDK--ITAF 245
            |.:|||..|::.||....|  :|:|||||.|||||..|:...|:|||    ....|.||  ||||
  Fly   164 PGAGSDVVSMKLRAERKGD--YYVLNGSKFWITNGSDADTLIVYAKT----GGSGVPDKHGITAF 222

Human   246 IVERDFGGVTNGKPEDKLGIRGSNTCEVHFENTKIPVENILGEVGDGFKVAMNILNSGRFSMGSV 310
            |||..:.|.:..:..||||:|||:|||:.|::.|:|.:||||:...|..|.|:.|:..|..:.:.
  Fly   223 IVETAWEGFSVAQKLDKLGMRGSSTCELVFQDLKVPAKNILGQENRGVYVLMSGLDFERLVLAAG 287

Human   311 VAGLLKRLIEMTAEYACTRKQFNKRLSEFGLIQEKFALMAQKAYVMESMTYLTAGMLD----QPG 371
            ..||::...::..:||..|||.||.:.||.|:|.|.|.|........|..|..|...|    .| 
  Fly   288 PVGLMQAACDVAFDYAHQRKQMNKLIGEFQLLQGKMADMYTTLSACRSYLYTVARSCDAGNRSP- 351

Human   372 FPDCSIEAAMVKVFSSEAAWQCVSEALQILGGLGYTRDYPYERILRDTRILLIFEGTNEILRMYI 436
             .||    |.|.::::|.|.:...:|:|||||.||..:.|..|||||.::..|..||:||.|..|
  Fly   352 -KDC----AGVILYTAEKATKVALDAIQILGGNGYINENPTGRILRDAKLYEIGAGTSEIRRWLI 411

Human   437  436
              Fly   412  411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACAD9NP_054768.2 VLCAD 38..445 CDD:173850 147/390 (38%)
CG6638NP_648239.1 PLN02519 14..418 CDD:215284 147/390 (38%)
IVD 38..417 CDD:173845 147/390 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.