DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACAD9 and Mcad

DIOPT Version :9

Sequence 1:NP_054768.2 Gene:ACAD9 / 28976 HGNCID:21497 Length:621 Species:Homo sapiens
Sequence 2:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster


Alignment Length:437 Identity:142/437 - (32%)
Similarity:225/437 - (51%) Gaps:48/437 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    13 AARACRGLV-VSTANRRLLRTSPPVRAFAKELFLGKIKKKEVFPFPEVSQDELNEINQFLGPVEK 76
            ||.|.|.|| .|.|...:...||...:||                  :::|:|    |......|
  Fly     8 AAPALRQLVSQSRAYAAVSHVSPNGTSFA------------------LTEDQL----QLQELARK 50

Human    77 FFTEEV--DSRKIDQEGKIPDETLEKLKSLGLFGLQVPEEYGGLG---FSNTM------YSRLGE 130
            |..||:  .:.:.|:.|:.|...::|...|||....:|.:.|||.   |:..:      |...|.
  Fly    51 FTREEIIPVAAQYDKSGEYPWPIIKKAWELGLMNNHIPADIGGLDLDVFTTCLSAEELAYGCTGI 115

Human   131 IISMDGSITVTLAAHQAIGLKGIILAGTEEQKAKYLPKLASGEHIAAFCLTEPASGSDAASIRSR 195
            :.:::.|         .:|...:||:|.:|||.|||.:|.....:||:|:|||.:|||.:.|::|
  Fly   116 MTALEAS---------GLGQTPVILSGNKEQKKKYLGRLLEEPLVAAYCVTEPGAGSDVSGIKTR 171

Human   196 ATLSEDKKHYILNGSKVWITNGGLANIFTVFAKTEVVDSDGSVKDKITAFIVERDFGGVTNGKPE 260
            |....|:  :::||.|:||||||:||.:.|.|:|. .|.........|.||||||..|:|.|:.|
  Fly   172 AEKKGDE--WVINGQKMWITNGGVANWYFVLARTN-PDPKCPPSKAFTGFIVERDSPGLTPGRKE 233

Human   261 DKLGIRGSNTCEVHFENTKIPVENILGEVGDGFKVAMNILNSGRFSMGSVVAGLLKRLIEMTAEY 325
            ..:|.|.|:|..:.||:.::|.||:|...|.|||:||...:..|..:.:...||.:|.::...:|
  Fly   234 LNMGQRASDTRGITFEDVRVPKENVLIGEGAGFKIAMGTFDKTRPPVAAGAVGLAQRCLDEALKY 298

Human   326 ACTRKQFNKRLSEFGLIQEKFALMAQKAYVMESMTYLTAGMLDQPGFPDCSIEAAMVKVFSSEAA 390
            |..||.|...::....:|...|.||...........|:|..:|| |..: |..|::.|..:::.|
  Fly   299 ALERKTFGVPIAYHQAVQFMLADMAIGVETSRLAWRLSAWEIDQ-GRRN-SYYASIAKCHAADMA 361

Human   391 WQCVSEALQILGGLGYTRDYPYERILRDTRILLIFEGTNEILRMYIA 437
            .:..|:|:||.||.|:..:||.|:::||.:|..|:|||::|.|:.|:
  Fly   362 NKIASDAVQIFGGNGFNSEYPVEKLMRDAKIYQIYEGTSQIQRLIIS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACAD9NP_054768.2 VLCAD 38..445 CDD:173850 132/411 (32%)
McadNP_648149.1 CaiA 35..411 CDD:224871 132/410 (32%)
MCAD 37..414 CDD:173846 130/390 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.