DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACAD9 and Egm

DIOPT Version :9

Sequence 1:NP_054768.2 Gene:ACAD9 / 28976 HGNCID:21497 Length:621 Species:Homo sapiens
Sequence 2:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster


Alignment Length:646 Identity:183/646 - (28%)
Similarity:287/646 - (44%) Gaps:92/646 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    10 TTAAARACRGLVVSTANRRLLRTSPPVRAFAKELFLGKIKKKEVFPFPEV-SQDELNEINQFLGP 73
            ||...|| ..:..|...:|.|.|..|:   ||..|:| :..||:..:||| .:||:.::...|.|
  Fly    44 TTEGGRA-ESVEESPEQQRKLPTREPL---AKNFFIG-VVDKELLAYPEVIPRDEMAQLENSLLP 103

Human    74 VEKFFTEEVDSRKIDQEGKIPDET----LEKLKSLGLFGLQVPEEYGGLGFSNTMYSRLGEIISM 134
            ::.:|.|             |.||    .|.|:.|||:||.|..:|.|.|:..:......|..|.
  Fly   104 LKNYFVE-------------PRETEETSPETLRQLGLYGLNVSTDYEGKGYGWSASLMASEPDST 155

Human   135 DGSITVTLAAHQAIG--LKGIILAGTEEQKAKYLPKLASGEHIAAFCLTEPASGSDAASIRSRAT 197
            |.::|:.|..|:.:.  ||.:   ||..|:.:||..||:|:.|....:.| .|..:.....:.|.
  Fly   156 DINVTLGLQTHRVVVDLLKEV---GTPLQQQRYLQDLATGKLIGTEAIYE-ISPPEEDYFNTTAE 216

Human   198 LSEDKKHYILNGSKVW-ITNGGLANIFTVFAKTEVVDSDGSVKDKITAFIVERDFGGVTNGKPED 261
            |..:...:.|||.|.: |...|...:|.|.|:|:..:..|.:....|.|:|:....||..|:...
  Fly   217 LFPEYGKWQLNGEKSFVICTPGERQLFLVLAQTQQPNVPGVLGRGTTIFLVDSQQEGVRLGEKHA 281

Human   262 KLGIRGSNTCEVHFENTKIPVENILGEVGDGFKVAMNILNSGRFSMGSVVAGLLKRLIEMTAEYA 326
            ..|.|.:....||||..|:..:.::|...||.:.:..::.|.|.....|...|.|:|:...|:|.
  Fly   282 TFGCRKAEIRRVHFEGVKLGEDQVVGLPHDGNRYSEQLVRSSRLRGSLVGLSLAKKLLNELAQYT 346

Human   327 CTRKQFNKRLSEFGLIQEKFALMAQKAYVMESMTYLTAGMLDQPGFPDCSIEAAMVKVFSSEAAW 391
            ....|...:|.:..|.:...:......|.||||.|||||:||:....|.::|:|:.|.|:....:
  Fly   347 VNTTQCGVQLQDLELTRIHMSRAMCSVYAMESMLYLTAGLLDEFRAQDVTLESAITKYFTLRQVY 411

Human   392 QCVSEALQILGGLGYTRDYPYERILRDTRILLIFEGTNEILRMYIALTGLQHAGRILTTRIHELK 456
            ...|:.|.::|..........|..|||...|.....:.:.|.|:||||||||||:.:.|.:    
  Fly   412 AIASQNLGVVGPKSLLSGETTELGLRDAAQLCTQGESLDTLGMFIALTGLQHAGQAMNTGV---- 472

Human   457 QAKVSTVMDTVGRRLRDSL-------GRTVDLGLTGNHGV------------VHPSLADSANKFE 502
                        |:.|:.|       |:.:|     |:.:            |||||..:|...|
  Fly   473 ------------RKSRNPLFNPGHIFGKFLD-----NNSIDNPKTKMQLSEHVHPSLEAAAQCIE 520

Human   503 ENTYCFGRTVETLLLRFGKTIMEEQLVLKRVANILINLYGMTAVLSRASRSIRIGLRNHDHEVLL 567
            .:.......||.:..:.|..::|.|..::|:|.:...:|.|.|.::|||||..|||...|||:|.
  Fly   521 LSVARLQMAVELMFTKHGNAVVERQSEMQRLAEVGTLIYAMWASVARASRSYCIGLPLADHELLT 585

Human   568 A-----------NTFCVEAYLQNLFSLSQLDKYAPENLDEQIKKVSQQILEKRAYICAHPL 617
            |           .|.|.|.|..:..           |.|..:.::|:|:.:.:.|...|||
  Fly   586 ATAICSEGRDRVRTLCTEIYGGHFV-----------NNDNNLVRLSKQVAKSKGYFAVHPL 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACAD9NP_054768.2 VLCAD 38..445 CDD:173850 123/414 (30%)
EgmNP_610687.1 ACAD 92..457 CDD:173838 106/381 (28%)
CaiA 122..439 CDD:224871 92/320 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3064
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D163462at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.