DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACAD9 and CG17544

DIOPT Version :9

Sequence 1:NP_054768.2 Gene:ACAD9 / 28976 HGNCID:21497 Length:621 Species:Homo sapiens
Sequence 2:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster


Alignment Length:402 Identity:98/402 - (24%)
Similarity:158/402 - (39%) Gaps:65/402 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    87 IDQEGKIPDETLEKLKSLGLFGLQVPEEYGGLGFS-NTMY-SRLGEIIS-MDGSITVTLAAHQAI 148
            :|::.::....:.::|.|.|    ||:|...|.|| .|.| ..:.|.:: ...|::|.:|....:
  Fly    67 MDEQKRLCAMQVNRMKHLDL----VPKEIESLSFSAKTKYLMYINEALACYSPSLSVKIALGVGL 127

Human   149 GLKGIILAGTEEQKAKYLPKLASGEHIAAFCLTEPASGSDAASIRSRATLSEDKKHYILN----- 208
            ....|...|||:.: ||:....:.|.|....:||.:.||:..|||:.||.....:.:::|     
  Fly   128 FNNAIRAMGTEKHQ-KYIEAAWNREVITCLAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFE 191

Human   209 GSKVWITN-GGLANIFTVFAKTEVVDSDG--------SVKDKITAFIVERDFGGVTNGKPEDKLG 264
            .:|.|:.| |..|.:...||.....|...        .::|..|..    .:.||..|...:|.|
  Fly   192 AAKCWVGNLGKTATVAMTFANLYTADGQNHGLHGFLIPIRDPKTLL----SYPGVLVGDIGEKCG 252

Human   265 IRGSNTCEVHFENTKIPVENILG----------------EVGDGFKVAMNILNSGRFSMGSVVAG 313
            :.|.:...|.|.|.:||.:|:|.                |.|.....|:...::||..:....|.
  Fly   253 LNGIDNGFVVFTNYRIPRDNLLNRTSDVTPEGVYESVFTEPGKVLGAALESFSAGRIGIMQESAN 317

Human   314 LLKRLIEMTAEYACTRKQFNKR-------LSEFGLIQEKF-----ALMAQKAYVME-SMTY---L 362
            .|.....:...|:..||||...       :.|:.|.|.:.     |...||....| :.||   :
  Fly   318 TLCSAAVIAVRYSAVRKQFGPERHGEEMAILEYQLHQYRIFPYLAAACVQKIATEELTSTYMEII 382

Human   363 TAGMLDQPGFPDCSIEAAMVKVFSSE-------AAWQCVSEALQILGGLGYTRDYPYERILRDTR 420
            .....|..||...:..||.:....|.       ||...:.||.:..||.||.:.....::..|..
  Fly   383 ARSQADSNGFDVLTQNAAEIHALISSSKPLITWAARDAIQEAREACGGHGYLQAAKLGQMRTDHD 447

Human   421 ILLIFEGTNEIL 432
            .|..:||.|.:|
  Fly   448 PLCTYEGDNNVL 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACAD9NP_054768.2 VLCAD 38..445 CDD:173850 98/402 (24%)
CG17544NP_001163015.1 AXO 16..670 CDD:173839 98/402 (24%)
PLN02443 18..687 CDD:178062 98/402 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.