DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACAD9 and CG9527

DIOPT Version :9

Sequence 1:NP_054768.2 Gene:ACAD9 / 28976 HGNCID:21497 Length:621 Species:Homo sapiens
Sequence 2:NP_001137800.1 Gene:CG9527 / 33898 FlyBaseID:FBgn0031813 Length:724 Species:Drosophila melanogaster


Alignment Length:597 Identity:132/597 - (22%)
Similarity:235/597 - (39%) Gaps:135/597 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    94 PDETLEKLKSLG-----------LFGLQVPEEYGGLGFSNTMYSRLGEIISMDGSITVTLAAHQA 147
            |...||:.:.:.           .:|:   .||  ||..:.:.:....|.|.|.|.:|.......
  Fly    98 PGSDLERTREMANKRQHLLWEQQFYGV---NEY--LGTPHLLLAFGQAIFSYDFSTSVKFGLSTG 157

Human   148 IGLKGIILAGTEEQKAKYLPKLASGEHIAAFCLTEPASGSDAASIRSRATLSEDKKHYILN---- 208
            : ....:::....:..||:.|:|....:.|:.|||.:.|::|..:|:|||....::.:|::    
  Fly   158 M-FPSTLVSNGSGRLGKYVAKIADNRILGAYALTEISHGTNALGMRTRATYDVKRQEFIIHTPDF 221

Human   209 -GSKVWITN-GGLANIFTVFAKTEVVDSDGSVKDK---ITAFIVE-RD------FGGVTNGKPED 261
             .:|.|:.| |.......|:|:..|.|      ||   :.||:|. ||      |.|||.|...:
  Fly   222 EAAKCWVGNLGKTCTHAIVYAQLYVPD------DKHQGLQAFLVPIRDERTLLPFPGVTVGDMGE 280

Human   262 KLGIRGSNTCEVHFENTKIPVENILGEVGD----------------GFKVAMNILNSGRFSMGSV 310
            |:|:.|.:...|.|...:||..|:|.:.||                ....::..|:.||.::.::
  Fly   281 KIGLNGIDNGFVMFNQYRIPKANLLSKTGDIDAQGNYTSKIKDERKRLGASLGALSVGRVNITAI 345

Human   311 VAGLLKRLIEMTAEYACTRKQFNKRLS--EFGLIQ---EKFALMAQ---------------KAYV 355
            ....|.:.:.:...||.:|:||....|  |:.:|:   :::.|:..               |..|
  Fly   346 TYVALSKAVTIATRYAASRRQFGPTNSPAEWPVIEYQSQQYRLIPHLATTIALRVATLWIGKENV 410

Human   356 MESMTYLTAGMLDQPGFPDCSIEAAMVKVFSSEAAWQCVSEALQILGGLGYTRDYPYERILRDTR 420
            ..:|...|.....|.|....:|.:|: |..::.||...:.|..:..||.||.:......:..|..
  Fly   411 DLTMKGFTGEDTSQAGMEIHAISSAL-KPVATWAARDGIQECREACGGHGYLKSSGLGELRNDND 474

Human   421 ILLIFEGTNEILRM---------------YIALTGLQHAG------RILTTRIHELKQAKV---- 460
            ....:||.|..|..               ::|::.|:...      .||.::..|...|:|    
  Fly   475 ANCTYEGENNTLIQQASNWLISLQRNNADFVAVSPLETVSFLKDMDTILQSKGQERTPAEVLDPL 539

Human   461 --------STV--MDTVGRRLRDSLGRTVDLGLTGNHGVVHPSLADSANKFEENTYCFG-RTVET 514
                    .||  :||..:|:.:......|...|.|:..|.     :|.|.   :..:| ||:..
  Fly   540 NLLNALNWLTVWQLDTTVKRVEEQQREGKDAFETRNNIQVF-----AAQKL---SIIYGERTIYY 596

Human   515 LLLRF--GKTIMEEQLVLKRVANILINLYGMTAVLSRASRSIRIG-LRNHDHEVLLANTFCVEAY 576
            :..:|  |.....|:.||::|    ::.||...|...::...|.| .|.:.::        :|.|
  Fly   597 VFYKFVIGLPDSAEKKVLQQV----LSFYGAHLVTKYSAAFYRGGYFRENSNQ--------LELY 649

Human   577 LQNLFSLSQLDK 588
            .|.:.:|..|.|
  Fly   650 EQGILALLPLLK 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACAD9NP_054768.2 VLCAD 38..445 CDD:173850 95/428 (22%)
CG9527NP_001137800.1 ACAD 52..694 CDD:299127 132/597 (22%)
PLN02312 56..682 CDD:215178 132/597 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.