DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACAD9 and CG4586

DIOPT Version :9

Sequence 1:NP_054768.2 Gene:ACAD9 / 28976 HGNCID:21497 Length:621 Species:Homo sapiens
Sequence 2:NP_572371.1 Gene:CG4586 / 31641 FlyBaseID:FBgn0029924 Length:677 Species:Drosophila melanogaster


Alignment Length:498 Identity:115/498 - (23%)
Similarity:187/498 - (37%) Gaps:115/498 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   142 LAAHQAIGLKGIILAGTEEQKAKYLPKLASGEH----IAAFCLTEPASGSDAASIRSRATLSEDK 202
            |..|.::.:..::..|||||:|::|.:   ..|    :..:..||...|:....:.:||......
  Fly   117 LRVHFSMFMTTLLSQGTEEQQAQWLNR---SWHMDGVLGTYAQTELGHGTFVRGLETRADYDPIT 178

Human   203 KHYILN-----GSKVWITNGGLANIFTVFAKTEVVDSDGSVKDK---ITAFIVE-RD------FG 252
            :.:|||     ..|.|  .|||.|.    |...:|.:...||.|   :.:|:|. ||      ..
  Fly   179 QEFILNTPTQSSYKWW--PGGLGNT----ANVAIVLAQLYVKGKHYGLQSFVVRIRDERTHEPLT 237

Human   253 GVTNGKPEDKLGIRGSNTCEVHFENTKIPVENILGEVGDGFKVAMNILNSGRFSMGSVVAGLLKR 317
            ||..|....:||..|.|...:...:.:||...:|            :.|:...:.|:.|.|....
  Fly   238 GVDVGDIGPRLGGNGVNNGFLGLRDVRIPRNQML------------MKNAQVLTDGTFVQGRPPL 290

Human   318 LIEMTAEYACTRKQFNKRLSEFGLIQEKFALMAQKAYVMESMTYLTAGMLDQPGFPDCSIEAAMV 382
            |:..|..|.   :....:...|||:|.  |.:|.:..|:...:.:.:   |||       |.:::
  Fly   291 LLYGTMVYV---RVITVKDVLFGLLQA--ATIATRYSVVRRQSRINS---DQP-------EVSVL 340

Human   383 KVFSSEAAWQCVSEAL-QILGGLGY--TRDYP---YERILRDTRILLIFEGTNEILRMYIALTGL 441
            ...:.:|      :.| ||..|:.|  ..|:.   ||.:||.    |..|.|.            
  Fly   341 DHITQQA------KILPQIARGVSYRLVSDWLWRFYEDVLRQ----LEDESTK------------ 383

Human   442 QHAGRILTTRIHELKQAKVSTVMDTVGRRLRDSLGRTVDL--GLTGNHGVVHPSLADSANKFEEN 504
               ||.....:|.|     |..:..|.   .|.....|||  ...|.||.:..:..||.......
  Fly   384 ---GRNSLPELHAL-----SCCLKAVA---TDEASEGVDLLRKSCGGHGFLSSANFDSIYGLTAA 437

Human   505 TYCFGRTVETLLLRFGKTIMEEQL-VLKRVANILINLYGMTAVLSRASRSIRIGLRNHDHEVLLA 568
            ||.:......|||:..:.::.:.. .|||            .||..:...:|...|....:.|:|
  Fly   438 TYTYEGEYTVLLLQTARFLVRQYADSLKR------------KVLPSSVSYLRDTARLIWGKNLVA 490

Human   569 NTFCVEAYLQNLFSLSQL-DKYAPENLDEQIKKVSQQILEKRA 610
            |  ||.|.  .:.::.|: |.:..:.: .|..|||.::....|
  Fly   491 N--CVRAL--EISAMEQVRDAWQTQKM-HQSGKVSPEMASNLA 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACAD9NP_054768.2 VLCAD 38..445 CDD:173850 75/327 (23%)
CG4586NP_572371.1 ACAD 6..653 CDD:299127 115/498 (23%)
PLN02443 7..677 CDD:178062 115/498 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.