DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REM1 and Rgk1

DIOPT Version :9

Sequence 1:XP_005260461.1 Gene:REM1 / 28954 HGNCID:15922 Length:306 Species:Homo sapiens
Sequence 2:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster


Alignment Length:392 Identity:114/392 - (29%)
Similarity:165/392 - (42%) Gaps:113/392 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     7 QEAKTPLHRRASTP----LPLSPRGHQPGRLSTVPST--QSQHPRL-------------GQS--- 49
            |..|.|..|.:..|    ||     .|..|::::|:|  :.::.||             |.|   
  Fly  1009 QSVKMPGSRASGRPNQLCLP-----QQRSRVASMPNTGVEEEYYRLRHFSITGKGVVNRGDSLKS 1068

Human    50 ---------ASLNP-----PTQKPSPAPDD-------WSSESSDSEGSWEALYRVVLLGDPGVGK 93
                     ||.|.     .||:...||..       .||..|.:.......|||::||.|.|||
  Fly  1069 RRSRSNNSVASSNSSTEHLTTQQQLSAPASVSARTSLASSRESSTSNPGNGPYRVLMLGGPAVGK 1133

Human    94 TSLASLFAGKQ-----ERDLHEQLGDPALPSVAEDVYERTLTVDGEDTTLVVVDTWEAEKLDKSW 153
            :||.|.|...:     :..:.::.|:.|:          ::.:.||::.|:.:|....|     .
  Fly  1134 SSLVSQFMTSEYLHAYDTSIDDESGEKAV----------SVLLSGEESELIFIDHGYTE-----M 1183

Human   154 SQESCLQG--GSAYVIVYSIADRGSFESASELRIQLRRTHQ-ADHVPIILVGNKADLARCREVSV 215
            :.:.||..  ...|.::||.|||.|| |.:|..:|:..|:| .....:|||.|||||||.|.|:.
  Fly  1184 TPDECLTNYDPHGYCVIYSAADRSSF-SVAEQVLQVLWTNQNIAQKAVILVSNKADLARSRLVTS 1247

Human   216 EEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLR-----------RRDSAAKE------- 262
            |||:|.|..:||||||||..:.|||.||..|::.|:||:           |:.|..|.       
  Fly  1248 EEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIRLKLENPEKSRDLFRKRSIRKSKRRACSP 1312

Human   263 ----------PPAP------RRPASLAQRARRFLARLTARSARRRALKAR-------SKSCHNLA 304
                      |..|      ..|.|.....|::....|:.|.:.:.|..|       ||||.||.
  Fly  1313 LNAGCLNANTPLGPLGEAVATPPGSAQSSPRKYRGSRTSTSLKVKGLLGRVWTRDSKSKSCENLH 1377

Human   305 VL 306
            ||
  Fly  1378 VL 1379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REM1XP_005260461.1 RGK 81..306 CDD:206715 87/273 (32%)
small_GTPase 81..245 CDD:197466 65/171 (38%)
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 87/273 (32%)
small_GTPase 1121..1286 CDD:197466 68/180 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5084
SonicParanoid 1 1.000 - - X743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.