DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GRB14 and pico

DIOPT Version :9

Sequence 1:NP_004481.2 Gene:GRB14 / 2888 HGNCID:4565 Length:540 Species:Homo sapiens
Sequence 2:NP_608363.1 Gene:pico / 33003 FlyBaseID:FBgn0261811 Length:1162 Species:Drosophila melanogaster


Alignment Length:342 Identity:105/342 - (30%)
Similarity:160/342 - (46%) Gaps:25/342 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    92 SVLSADLFPKANSR------KKQVIKVYSEDETSRALDVPSDITARDVCQLLILKNHYIDDHSWT 150
            |:..||....|..:      ::..:|.::.|..|::|.|...:....|.:||..|||.....:|.
  Fly   346 SITKADKIQLALHKLESAPIRRLFVKAFTSDGASKSLLVDERMGCGHVTRLLADKNHVQMQSNWA 410

Human   151 LFEHLPHIGVERTIEDHELVIEVLSNWGIEEENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATET 215
            |.|||..:.:||..|||||:::.|..|..:..|::.|::...|...|..|..:.|...::...: 
  Fly   411 LVEHLGDLQMERLFEDHELLVDNLMTWHSDAGNRVLFQQRPDKVTLFLRPELYLPGPQMAPGCQ- 474

Human   216 NGEISPTQILQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFF 280
            :.|.:...:|..|..|....::.|.|:.|...||.||:.:|.||.||||:..|..:|..|.|...
  Fly   475 HDEQTRQMLLDEFFDSHNQLQMDGPLYMKADPKKGWKRYHFVLRSSGLYYFPKEKTKNTRDLACL 539

Human   281 SEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGP-------RDLKMLCAEEEQSRTCWVTAIR 338
            :.|...::|..|..:||..:||:|.|.|   ||.|.       |.|||||||:..:...|:||||
  Fly   540 NLFHGHNVYTGLGWRKKWKSPTDYTFGF---KAVGDSSLGKSCRSLKMLCAEDLPTLDRWLTAIR 601

Human   339 LLKYGMQLYQNYMHPYQ----GRSGCSSQS--ISPMR--SISENSLVAMDFSGQKSRVIENPTEA 395
            :.|||.||:.::....:    .|....|||  .:.||  |||..|.......|..|..|.:.:.:
  Fly   602 VCKYGKQLWDSHKSLLEDLCLSRDDAVSQSSFAASMRSESISSISSAVPSQCGSVSSAISSMSNS 666

Human   396 LSVAVEEGLAWRKKGCL 412
            .|.......:....|||
  Fly   667 TSGRTSRASSSSSSGCL 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GRB14NP_004481.2 RA_GRB14 107..191 CDD:340556 27/83 (33%)
PH_APBB1IP 230..351 CDD:269961 50/127 (39%)
BPS 370..414 CDD:401046 11/43 (26%)
SH2_Grb14 433..540 CDD:198277
picoNP_608363.1 GRB7_RA 364..451 CDD:176382 27/86 (31%)
PH_APBB1IP 489..614 CDD:269961 50/127 (39%)
PH 494..605 CDD:278594 44/113 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157314
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.