DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eif4h and eIF4B

DIOPT Version :9

Sequence 1:NP_001006958.1 Gene:Eif4h / 288599 RGDID:1359222 Length:248 Species:Rattus norvegicus
Sequence 2:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster


Alignment Length:268 Identity:68/268 - (25%)
Similarity:119/268 - (44%) Gaps:66/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Rat    36 LPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVR-DKDTDKFKGFCYVEFDEVDSLKEAL 99
            :|.:.|:.||:.||||:..:.|:...|:.:::.|:||.| |.:..:.:||.|||.:..:.|...|
  Fly    74 IPHKAPFIAYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENREDLIHVL 138

  Rat   100 TYDGALLGDRSLRVDIA-----EGRKQDKGGFGFRKGGPDDRGMGGSREPRGGW--DSRDDFSS- 156
            :.....:..|.:|::::     :.|::....|       |..|..|.....|.|  ||:::.|: 
  Fly   139 SLPDPSIKGRRIRIELSNENDQQSRQKSNRRF-------DGFGNNGDNRDSGNWRRDSQNNGSNF 196

  Rat   157 GY-----------------RDDFL---GGRGGSRPGD------RRAGPPMGSRFRDGPPLRGSNM 195
            ||                 |||..   ..|..:||..      ||....:..::|:| .::.::.
  Fly   197 GYSSNFERSFNRERKSLPDRDDVNTPGSWRTSARPQSIDTSPTRREVEQVSEKYREG-RVKIADR 260

  Rat   196 DFREPTEEERAQRPRLQLKPRTVATP----------------LNQVANPNSA-IFGGARP----- 238
            ..||.|.:...:||:|.|||||:..|                |::....:|. :||.|:|     
  Fly   261 YSREETSKVEEERPKLNLKPRTLPLPDVKTIEFEKCDVDEFNLDKQGGTSSLNVFGSAKPVDTAA 325

  Rat   239 RE-EVVQK 245
            || |:.|:
  Fly   326 RELEIEQR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eif4hNP_001006958.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 1/4 (25%)
RRM_eIF4H 37..120 CDD:409835 24/88 (27%)
SF-CC1 <40..>227 CDD:273721 58/237 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..248 43/177 (24%)
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 49/201 (24%)
RRM_eIF4B 79..155 CDD:240848 23/75 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.