DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ncam2 and DIP-delta

DIOPT Version :10

Sequence 1:NP_981954.2 Gene:Ncam2 / 288280 RGDID:1303131 Length:837 Species:Rattus norvegicus
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:448 Identity:104/448 - (23%)
Similarity:175/448 - (39%) Gaps:72/448 - (16%)


- Green bases have known domain annotations that are detailed below.


  Rat   201 IIVIVNVPPAIVMPQKSF-----NATAERGEEMTLTCKASGSPDPAISWFR---------NGKLI 251
            :|.:.|:...::|.:..|     |.|...|.:..|.|.........::|..         :..:|
  Fly    29 LIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVI 93

  Rat   252 EENEKY-ILKGSNTELT-VRNIINKDGGSYVCKATNKAGEDQKQAFLQVFVQPHILQLKNETTS- 313
            ....:| |....||.|. |......|.|.|:|:........| ..:|||.|.|:||.:::..:| 
  Fly    94 SRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQ-VGYLQVVVPPNILDIESTPSSV 157

  Rat   314 ---ENGHVTLICEAEGEPVPEITWKRAIDGVTFSEGDKSPDGRIEVKGQ---HGRSSLHIRDVKL 372
               ||.::.:.|.|:|.|.|:|.|:|. ||...:         :|.|.:   :....|.:..|..
  Fly   158 AVRENQNINMTCRADGFPAPKIIWRRE-DGEEIA---------VEKKKKVLVYDADVLPLTKVSR 212

  Rat   373 SDSGRYDCEAASRI-GGHQRSMHLDIEYAPK-FVSNQTMYYSWEGNPINISCDVKANPPASIHW- 434
            ::.|.|.|.|.:.: ....:.:.||:|::|. :|.|| :..:..|..:.|.|..:|:|.|.|:| 
  Fly   213 NEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQ-LVGAPSGTDVTIDCHTEAHPKAIIYWV 276

  Rat   435 RREKLVLPAKN-TTHLKTHSVGRKMILEIAPTSDNDFGRYNCTATNRIGT---RFQEYILELADV 495
            ....:|||:|. .|....:|....|.|.|......|||.|.|.:.|.:|.   ..:.|.:.|...
  Fly   277 YNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPST 341

  Rat   496 PSSPRGVKIIELSQTTAKISFNK--PESHGGVPIHHYQVDV---------------KEVTSETWK 543
            ||.       :::.||.:...|.  |.|.... ....|.||               ......:..
  Fly   342 PSK-------QVTHTTVESRENNIIPSSRNDT-TKSLQTDVGYAMKNDLYPGSASSSSSGGSSSA 398

  Rat   544 IVRSHGVQTTVVLSSLEPNTTYEVRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHG 601
            ...|..:||:.:...:..|:     ::::..||.....|...:...|..|.:..|:.|
  Fly   399 ASSSSSMQTSALPGGVAGNS-----LSSMGSKGSLAIGKSTFYTERPPNEYAASSVAG 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ncam2NP_981954.2 IgI_1_NCAM-2 21..113 CDD:409452
Ig strand A 21..26 CDD:409452
Ig strand A' 29..33 CDD:409452
Ig strand B 35..45 CDD:409452
Ig strand C 49..55 CDD:409452
Ig strand C' 58..60 CDD:409452
Ig strand D 66..72 CDD:409452
Ig strand E 74..82 CDD:409452
Ig strand F 89..96 CDD:409452
Ig strand G 101..112 CDD:409452
Ig 117..193 CDD:472250
Ig strand B 132..136 CDD:409353
Ig strand C 145..152 CDD:409353
Ig strand E 169..173 CDD:409353
Ig strand F 183..187 CDD:409353
Ig strand G 191..194 CDD:409353
IgI_1_MuSK 209..298 CDD:409562 21/104 (20%)
Ig strand A 209..212 CDD:409562 0/2 (0%)
Ig strand A' 217..222 CDD:409562 2/9 (22%)
Ig strand B 228..235 CDD:409562 2/6 (33%)
Ig strand C 241..246 CDD:409562 1/4 (25%)
Ig strand C' 248..250 CDD:409562 0/1 (0%)
Ig strand D 257..260 CDD:409562 2/3 (67%)
Ig strand E 264..270 CDD:409562 3/6 (50%)
Ig strand F 277..284 CDD:409562 3/6 (50%)
Ig strand G 290..298 CDD:409562 2/7 (29%)
Ig 300..397 CDD:472250 26/104 (25%)
Ig strand B 318..322 CDD:409353 0/3 (0%)
Ig strand C 331..335 CDD:409353 1/3 (33%)
Ig strand E 363..367 CDD:409353 1/3 (33%)
Ig strand F 377..382 CDD:409353 2/4 (50%)
Ig strand G 390..393 CDD:409353 0/2 (0%)
Ig_3 401..479 CDD:464046 26/80 (33%)
FN3 496..588 CDD:238020 17/108 (16%)
fn3 594..678 CDD:394996 2/8 (25%)
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 21/92 (23%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 0/3 (0%)
Ig strand E 105..112 CDD:409353 3/6 (50%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/3 (33%)
Ig 145..238 CDD:472250 25/102 (25%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 28/91 (31%)
Ig strand B 259..263 CDD:409353 1/3 (33%)
Ig strand C 272..276 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 3/9 (33%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.