DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scarf2 and NimA

DIOPT Version :9

Sequence 1:XP_038944006.1 Gene:Scarf2 / 287949 RGDID:1306013 Length:838 Species:Rattus norvegicus
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:441 Identity:105/441 - (23%)
Similarity:153/441 - (34%) Gaps:126/441 - (28%)


- Green bases have known domain annotations that are detailed below.


  Rat   287 CTVVEGRCLTCEPGW---------NGTKCDQPCATGFYGEGCGHR--CPP-CRDGHACNHVTGKC 339
            |..:..||.|.:...         |.|:..:.|..|:.|.....:  |.| ||.|  |..  |.|
  Fly    80 CMEIPPRCATFKTEMREVMRVQKLNKTRTVRFCCQGYEGNLSDSQATCKPICRGG--CGR--GSC 140

  Rat   340 T-----HCNAGWIGDRCETKCSNGTYGEDCAFVCSDCGSGHCDFQSGRCLCSPGVHGPHCNVTCP 399
            .     .|..|:||..|..:|.:..:|.||..:|.......||.:||.|.|..|..|..|.:.||
  Fly   141 VMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGWTGQFCELPCP 205

  Rat   400 AGLHGVDCAQACSCHEESCDPVTGACHLETNQRKGVMGAGALLTLLLGLLLSLLGCCCACRGKDS 464
            .|.:|:.|.:||.|.|:.|:|.||||..:....:  :....::...:...|..:|..        
  Fly   206 QGTYGIMCRKACDCDEKPCNPQTGACIQQDQPLQ--LNVSHVIVETVNSTLEKMGII-------- 260

  Rat   465 ARRPRPRRELTLGRKKAPQRFCGSFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPS 529
               |||...:.|     |:       .|.:|.|......|..||::| |....:.|........:
  Fly   261 ---PRPTTPVPL-----PE-------VIVIKQPTSNENAQHSPKIIV-HQSSSDLLENLHTAAAA 309

  Rat   530 GLEQP-----------SPS------WSSRASFSSFDTTDE---------------------GPVY 556
            |:..|           ||.      ....|:.|...|.|.                     |.:|
  Fly   310 GVPTPEVIHVITNGITSPQEHLAGFVGGEANSSQTATADHQSGLVVTLVSIMLLLLVAIAVGSLY 374

  Rat   557 C---VPHEEATAENRDPEASASLTEVPA---VSLA----------------PMGTSVPGDEAAAL 599
            .   ..|:.|...|    |:.::|.:||   |.|.                |:..:|......|.
  Fly   375 VYRRYHHKNAAVYN----ANGTVTTLPANPEVVLTEAAVLGKNFHEPLPEPPVAFAVTPQSNEAQ 435

  Rat   600 PASSDSERSASSVEGPGGALYARVARREARPARTRCEAGGLSLSPSPERRK 650
            |...||..:.||::.|.   || .||:|:           |....||:.||
  Fly   436 PELYDSPSNNSSIKTPP---YA-YARKES-----------LYSVVSPKSRK 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Scarf2XP_038944006.1 exchanger_TraA <74..431 CDD:411343 51/160 (32%)
PHA03247 <683..837 CDD:223021
NimANP_001285918.1 EMI 52..116 CDD:284877 7/35 (20%)
EGF_2 170..200 CDD:285248 10/29 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.