DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf145 and hrd1

DIOPT Version :9

Sequence 1:NP_001099248.1 Gene:Rnf145 / 287212 RGDID:1309561 Length:664 Species:Rattus norvegicus
Sequence 2:NP_596376.1 Gene:hrd1 / 2539900 PomBaseID:SPBC17D11.02c Length:677 Species:Schizosaccharomyces pombe


Alignment Length:514 Identity:103/514 - (20%)
Similarity:179/514 - (34%) Gaps:177/514 - (34%)


- Green bases have known domain annotations that are detailed below.


  Rat   229 VLFMVFWLVLFALQIYSYFSTRDQPASRERLLFLFLTSIAECCSTPYSLLGLVF-TVSFVALGV- 291
            :|:::..||||.|.:               ||.|:.:      :..||...::. :...:.:|: 
pombe     4 ILYVLASLVLFGLSV---------------LLSLYSS------ANVYSATVMISQSPVHITIGLN 47

  Rat   292 LTLCKFYLQGYRAFMNDPAMNRGMTEGVTLLILAVQTGLIELQVVHRAFLLSIILFIVVASILQS 356
            :.||.|:     |..|  |:.       |||..::||  .||::::..|.:::            
pombe    48 VCLCLFF-----AIAN--ALK-------TLLFGSLQT--FELELLYEQFWITL------------ 84

  Rat   357 MLEIADPIVLALGASRDKSLWKHFRAVSLCLFLLVFPAYMAYMICQF-------------FHM-- 406
                 ..|:||:...|:......|..:|..:|..||     :.||.|             ||:  
pombe    85 -----TEIMLAITVFREAISISFFMLLSTLMFARVF-----HSICSFRTERLQIQLTDQRFHIFS 139

  Rat   407 ----DFWLLIIISSSILTSLQVLGTLFIYVLFMVEEFRKEPVENMDDVIYYVNGTYRLLEFLV-- 465
                .:::|.|:.:|:           ||:.|..|....:...    :::....:..||...:  
pombe   140 RLTCAYFVLSILDASL-----------IYLCFTSEHLGDKSTR----MLFVCEFSVLLLNLTIEA 189

  Rat   466 -ALCVVAYGVS--ETIFGEWT--------------VMGSMIIFIHS-----------------YY 496
             .||:..|...  :.::.|.:              ::...::|::.                 :|
pombe   190 SKLCIYLYEARHLDQVWDEKSTYLFRLEVCRDGLRLLAYSLLFMYQFPYVSVPIYSIRQMYTCFY 254

  Rat   497 NVWLRAQLGWKSFLLRRDAVNKIKSL-PIATKEQLERHNDICAICYQDM---------------- 544
            :::.|.    :.....|.|...:.:: |.||:|||...:..|.||.::|                
pombe   255 SLFRRI----REHARFRQATRDMNAMYPTATEEQLTNSDRTCTICREEMFHPDHPPENTDEMEPL 315

  Rat   545 -KSAVIT----PCSHFFHAGCLKKWLYVQDTCPLC-HCHLKNSSQLPGLGTEP----------AP 593
             :...:|    ||.|..|..||:.||..|.|||:| ...:.|.|...|:...|          .|
pombe   316 PRGLDMTPKRLPCGHILHFHCLRNWLERQQTCPICRRSVIGNQSSPTGIPASPNVRATQIATQVP 380

  Rat   594 QP---PVAGAEQNIVLQEGPEPPDHETPPGPGAQEGSG------DNSEYINRSSASREG 643
            .|   |...|...|........|...|..|......||      |.|..|.|..|.|:|
pombe   381 NPQNTPTTTAVPGITNSSNQGDPQASTFNGVPNANSSGFAAHTQDLSSVIPRRIALRDG 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf145NP_001099248.1 TRC8_N 8..506 CDD:404574 56/333 (17%)
HRD1 <520..643 CDD:227568 44/164 (27%)
RING-H2_RNF145 533..575 CDD:319598 18/63 (29%)
hrd1NP_596376.1 HRD1 1..514 CDD:227568 103/514 (20%)
zf-RING_2 291..351 CDD:290367 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.