DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsd17b6 and Adhr

DIOPT Version :9

Sequence 1:NP_775427.2 Gene:Hsd17b6 / 286964 RGDID:708343 Length:327 Species:Rattus norvegicus
Sequence 2:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster


Alignment Length:166 Identity:45/166 - (27%)
Similarity:66/166 - (39%) Gaps:43/166 - (25%)


- Green bases have known domain annotations that are detailed below.


  Rat   119 LVNNAGVFQAFAYIEWCRPEDCMSIFQVNLIGLAQVTLSML-FLVKK---ARGRIVNVSSVLG-- 177
            |:|.|.:         |...:..:....||.|:.....::| ::.:|   ..|.||||:||:|  
  Fly    89 LINGATL---------CDENNIDATINTNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTSVIGLD 144

  Rat   178 RVALFGGFYSCSKYGVEAFSDVLRREIRD------FGVKVSIIEPGSFKTRM-TDAELIIEKTKK 235
            ...:|.. ||.||:||..|:    |.:.|      .||.|..:..|  .||: .|.||       
  Fly   145 PSPVFCA-YSASKFGVIGFT----RSLADPLYYSQNGVAVMAVCCG--PTRVFVDREL------- 195

  Rat   236 TWEATPEHIRESYGQQFFDDFCNTTRRELKKCSTNL 271
              :|..|     |||.|.|.......:....|..|:
  Fly   196 --KAFLE-----YGQSFADRLRRAPCQSTSVCGQNI 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsd17b6NP_775427.2 None
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 45/166 (27%)
adh_short 7..195 CDD:278532 34/121 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.