DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P2RY8 and Aplnr

DIOPT Version :9

Sequence 1:XP_006724506.2 Gene:P2RY8 / 286530 HGNCID:15524 Length:548 Species:Homo sapiens
Sequence 2:NP_112639.1 Gene:Aplnr / 83518 RGDID:621645 Length:377 Species:Rattus norvegicus


Alignment Length:351 Identity:90/351 - (25%)
Similarity:150/351 - (42%) Gaps:51/351 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   215 LPVVYSLVAAVSIPGNLFSLW-VLCRRMGPRSPSVIFMINLSVTDLMLASVLPFQIYYHCNRHHW 278
            :|.:|.||..:...||...|| |.......|..:.||:.:|:|.||.....||....|......|
  Rat    29 IPAIYILVFLLGTTGNGLVLWTVFWSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYREFDW 93

Human   279 VFGVLLCNVVTVAFYANMYSSILTMTCISVERFLGVLYPLSSKRWRRRRYAVAACAGTWLLLLTA 343
            .||...|.:.:...:.|||:|:..:|.:|.:|:|.::.|:::.|.|.|.....|.|..|:|....
  Rat    94 PFGTFSCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALL 158

Human   344 LSPL---ARTDL--------TYPVHALGIITCFDVLKWTMLPSVAMWAVFLFTIFILLFLIPFVI 397
            ..|:   ..||:        .|..::: :.|......|.:...|:..||.        |::||:|
  Rat   159 AVPVMVFRSTDIPENSTKTQCYMDYSM-VATSNSEWAWEVGLGVSSTAVG--------FVVPFII 214

Human   398 TVACY---TATILKLLRTEEAHGREQRRRAVGLAAVVLLAFVTCFAPNNFVLLAHIVSRLF---- 455
            .:.||   ..||....|.|...|..:|||.:.:..|:::.|..|:.|.:.|...:::..|.    
  Rat   215 MLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGNLLHWPC 279

Human   456 -YGKSYYHVYKLTLCLSCLNNCLDPFVYYFASREFQLRLREYL-----GCRRVPRDTLDTRRESL 514
             :.....:|:....|:|.:|:||:||:|.|....|:......|     ||:..|..:        
  Rat   280 DFDSFLMNVFPYCTCISYVNSCLNPFLYAFFDPRFRRACTSMLCCDQSGCKGSPHSS-------- 336

Human   515 FSARTTSVRSEAGAHPEGMEGATRPG 540
             ||..::  |.:..|.:|      ||
  Rat   337 -SAEKSA--SYSSGHSQG------PG 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P2RY8XP_006724506.2 7tm_4 222..>321 CDD:304433 29/99 (29%)
7tm_1 229..482 CDD:278431 72/272 (26%)
AplnrNP_112639.1 7tmA_Apelin_R 17..318 CDD:341340 79/297 (27%)
TM helix 1 29..53 CDD:341340 9/23 (39%)
TM helix 2 63..84 CDD:341340 8/20 (40%)
TM helix 3 101..123 CDD:341340 5/21 (24%)
TM helix 4 146..162 CDD:341340 4/15 (27%)
TM helix 5 197..220 CDD:341340 8/30 (27%)
TM helix 6 245..267 CDD:341340 5/21 (24%)
TM helix 7 286..311 CDD:341340 10/24 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..377 7/36 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
HGNC 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.