DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P2RY8 and Agtr1b

DIOPT Version :9

Sequence 1:XP_006724506.2 Gene:P2RY8 / 286530 HGNCID:15524 Length:548 Species:Homo sapiens
Sequence 2:NP_112271.2 Gene:Agtr1b / 81638 RGDID:2071 Length:359 Species:Rattus norvegicus


Alignment Length:342 Identity:84/342 - (24%)
Similarity:148/342 - (43%) Gaps:37/342 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   207 RNPAIAVALPVVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVIFMINLSVTDLMLASVLPFQIYY 271
            |:..|.|.:|.:||::..|.|.||...:.|:...|..::.:.:|::||::.||.....||....|
  Rat    23 RHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVY 87

Human   272 HCNRHHWVFGVLLCNVVTVAFYANMYSSILTMTCISVERFLGVLYPLSSKRWRRRRYAVAACAGT 336
            ....:.|.||..||.:.:.:...|:|:|:..:||:|::|:|.:::|:.|:..|....|...|...
  Rat    88 TAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIII 152

Human   337 WLLLLTALSPLARTDLTYPVHALGIITC---FDVLKWTMLPSVAMWAVFLFTIFILLFLIPFVIT 398
            ||:...|..|.......|.:....|..|   ::....|:...:.:      |..||.|:.||:|.
  Rat   153 WLMAGLASLPAVIYRNVYFIENTNITVCAFHYESQNSTLPIGLGL------TKNILGFVFPFLII 211

Human   399 VACYTATILKLLRTEEAHGREQRRRAVG--LAAVVLLAFVTCFAPNNFVLL-------------- 447
            :..||.....|.:..:......|...:.  :.|:||..|.:......|..|              
  Rat   212 LTSYTLIWKALKKAYKIQKNTPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEI 276

Human   448 AHIVSRLFYGKSYYHVYKLTLCLSCLNNCLDPFVYYFASREFQ---LRLREYLGCRRVPRDTLDT 509
            |.||..         ...:|:|::..||||:|..|.|..::|:   |:|.:|:.........|.|
  Rat   277 ADIVDT---------AMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPTAKSHAGLST 332

Human   510 RRESLFSARTTSVRSEA 526
            :..:|....:.::.|.|
  Rat   333 KMSTLSYRPSDNMSSSA 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P2RY8XP_006724506.2 7tm_4 222..>321 CDD:304433 28/98 (29%)
7tm_1 229..482 CDD:278431 65/271 (24%)
Agtr1bNP_112271.2 7tm_4 37..262 CDD:304433 56/230 (24%)
7tm_1 45..302 CDD:278431 65/271 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..359 2/11 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
HGNC 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.